Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1745 bp · TkA07G043930|TK1151|cDNA
TTTGATTGTAATACAAAAAGCTAGTTCGGCGTACCCCAACACTACTCTCTCTCTCTCTCTCTGCCTCTTCGCACCGTAATATCGTTCGGTGGTGGTTCTACCGGCGGTGTGTGGAGAGTAAAATGCCTGTTCAAAAGCATCCGGATGATTCTCTGTCTGCGGAAGAGGACGATGTTGAGCTGCAACGTAGTAATCAGAATATTTCGGAAGAATCCGAAGAAGACGACGTACAACAAGAGGAACAAGAGTCGGATGACGAT...
1407 bp · TkA07G043930|TK1151|CDS
GCTAGTTCGGCGTACCCCAACACTACTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGCCTCTTCGCACCGTAATATCGTTCGGTGGTGGTTCTACCGGCGGTGTGTGGAGAGTAAAATGCCTGTTCAAAAGCATCCGGATGATTCTCTGTCTGCGGAAGAGGACGATGTTGAGCTGCAACGTAGTAATCAGAATATTTCGGAAGAATCCGAAGAAGACGACGTACAACAAGAGGAACAAGAGTCGGATGACGA...
Protein
Download Protein FASTA468 aa · TkA07G043930|TK1151|PROTEIN
ASSAYPNTTLSLSLSLSLSLSASSHRNIVRWWFYRRCVESKMPVQKHPDDSLSAEEDDVELQRSNQNISEESEEDDVQQEEQESDDDGSPSSSSSDKDEFVSVNLADVRKEFQCPICLGIIRKTRKVMECLHRFCRECIDKSMRLGNNECPACRAHCASRRSLRDDPNYDALIALLYPDIDKYEKEELALHEEEIARNKKIQASIAQTSRRQLEALGKKRATAKATATAFMRRSHQSNPRNLRGRKRQKSTEPQLSDNEL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G043930 |
|---|---|
| TK1151 ID | TkA07G043930 |
| OH-1004 ID | LXL04_027271 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 89.744 / OH-1004 90.713Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G043930 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:11656502-11660762 (+) | |||||||||
| Description | Similar to RING1A: Putative E3 ubiquitin-protein ligase RING1a | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0001709 cell fate determination Biological Process GO:0006325 chromatin organization Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0007281 germ cell development Biological Process GO:0009845 seed germination Biological Process GO:0009948 anterior/posterior axis specification Biological Process GO:0010076 maintenance of floral meristem identity Biological Process GO:0010077 maintenance of inflorescence meristem identity Biological Process GO:0010467 gene expression Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G03770 ath:AT5G44280 mmu:19821 pon:100174504 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09179TilS16-47 aaPF23501Microp_apicomplexa_434-91 aaPF06512Na_trans_assoc54-94 aaPF01080Presenilin56-90 aaPF14835zf-RING_6105-154 aaPF23320Zn_SUZ12106-118 aaPF11789zf-Nse109-153 aaPF14570zf-RING_4110-117 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G043930 | PF09179 | TilS | 16 | 47 | 0.17 | 12.9 |
| TkA07G043930 | PF23501 | Microp_apicomplexa_4 | 34 | 91 | 0.021 | 16.2 |
| TkA07G043930 | PF06512 | Na_trans_assoc | 54 | 94 | 0.46 | 11.5 |
| TkA07G043930 | PF01080 | Presenilin | 56 | 90 | 1.3 | 8.4 |
| TkA07G043930 | PF14835 | zf-RING_6 | 105 | 154 | 0.32 | 11.6 |
| TkA07G043930 | PF23320 | Zn_SUZ12 | 106 | 118 | 0.23 | 12.0 |
| TkA07G043930 | PF11789 | zf-Nse | 109 | 153 | 0.17 | 12.5 |
| TkA07G043930 | PF14570 | zf-RING_4 | 110 | 117 | 0.016 | 15.7 |
| TkA07G043930 | PF26082 | zf-C2H2_AcuF | 110 | 122 | 0.085 | 13.2 |
| TkA07G043930 | PF13920 | zf-C3HC4_3 | 111 | 158 | 0.00074 | 20.0 |
| TkA07G043930 | PF13923 | zf-C3HC4_2 | 113 | 153 | 2.7e-11 | 43.8 |
| TkA07G043930 | PF13639 | zf-RING_2 | 113 | 154 | 6e-08 | 33.5 |
| TkA07G043930 | PF14634 | zf-RING_5 | 113 | 154 | 7.7e-05 | 23.3 |
| TkA07G043930 | PF17123 | zf-RING_11 | 113 | 139 | 0.89 | 10.0 |
| TkA07G043930 | PF00097 | zf-C3HC4 | 114 | 153 | 9.8e-10 | 38.9 |
| TkA07G043930 | PF13445 | zf-RING_UBOX | 114 | 151 | 0.00011 | 22.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.