TkA07G041100 | RubberDandelionOmics

Gene overview

TkA07G041100

Reference: TK1151 Chr: Chr07 Coordinates: 11009737-11014831 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2101 bp · TkA07G041100|TK1151|cDNA

CTAAAACTGGATACATTGAAAAACTAAAATTGAATCTAGAATTAGTAGTTATTATTGTTTAGGAGAGAGTGAGAATTCATAGCAAAACCGCAAAACCCTTGTTGATCTCTCTTCGAAATTTGCAACTTCACTCCCTCCTAATTTTAGTCCAAGTTCTCCTCGACTGTTAGCTCGCACTCCACCCTTCAGACATCTTGGAACATCAATGGAGGAAGACGACGGAGCTCCATCACGGCGGTCATCACCACCGACTCCAAAAA...

CDS

Download CDS FASTA

1587 bp · TkA07G041100|TK1151|CDS

ATGGAGGAAGACGACGGAGCTCCATCACGGCGGTCATCACCACCGACTCCAAAAAAGATTAAGATGGAGTCGGAAGAACCAAAAGAATCATTAATAAAGGTCAAGGATCATTCCGAAGATGAATCCGAGGAAATTGAAGCTGACGATGAAGAGGAAGATGGATCACCACAGTTACCGCTGTTATTAGACATGATTGACCTTCCACCCTCTTCCCCTTTACCTCCTACTCCGCCTCTTCCGTCTTCACCTAGAGATTTATA...

Protein

Download Protein FASTA

528 aa · TkA07G041100|TK1151|PROTEIN

MEEDDGAPSRRSSPPTPKKIKMESEEPKESLIKVKDHSEDESEEIEADDEEEDGSPQLPLLLDMIDLPPSSPLPPTPPLPSSPRDLYMEQQDSEDEGPPPGWDNLYQHKEQVGHIITPAAISAIPSDIKMEDMQEDARNGDGGAPDIVASDIKVEEQDSEDEGPPPGWDSKCQPEPNSQMACPTITQSDVQEDACNGDGPQQRLTISIPSDVKMEEQESEDEGPPPGWDSKCQPELQTPCQTPTITQSDIKTEDVQQEPQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G041100`
TK1151 ID	TkA07G041100
OH-1004 ID	LXL04_027240
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G041100

Location Chr07:11009737-11014831 (-)

Description Similar to LOL5: Protein LOL5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21610`	Putative zinc finger that may be involved in programmed cell death and defense response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027240 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0098542 defense response to other organism Biological Process

GO:2000121 regulation of removal of superoxide radicals Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G32540

ath:AT4G21610

dosa:Os01g0612700

dosa:Os03g0639600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.580

Rank 1 · TkA07G041100 · TK1151

Cytoplasm0.492

Rank 2 · TkA07G041100 · TK1151

Cell membrane0.075

Rank 3 · TkA07G041100 · TK1151

Mitochondrion0.058

Rank 4 · TkA07G041100 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA07G041100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23548Zn_ribbon_FGT1_2179-183 aa

PF23548Zn_ribbon_FGT1_2432-456 aa

PF06943zf-LSD1435-456 aa

PF23548Zn_ribbon_FGT1_2470-497 aa

PF06943zf-LSD1473-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G041100	`PF23548`	Zn_ribbon_FGT1_2	179	183	2.6e-05	24.4
TkA07G041100	`PF23548`	Zn_ribbon_FGT1_2	432	456	2.6e-05	24.4
TkA07G041100	`PF06943`	zf-LSD1	435	456	9.2e-15	55.0
TkA07G041100	`PF23548`	Zn_ribbon_FGT1_2	470	497	2.6e-05	24.4
TkA07G041100	`PF06943`	zf-LSD1	473	496	9.2e-15	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65426`	Arabidopsis thaliana	sp\|O65426\|LOL2_ARATH Protein LOL2	59.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card