TkA07G040880 | RubberDandelionOmics

Gene overview

TkA07G040880

Reference: TK1151 Chr: Chr07 Coordinates: 10953661-10954566 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

740 bp · TkA07G040880|TK1151|cDNA

TACGTGTATCGAGTGGATCATTAAATCGGTAAACCACAACGCGTACATAATGATTGCTATCACGGGTGAAGGGTTTTTTGCGGCGTCTGCAACCGCGACTGAATTGATTAAGAACAATATTCTTCGAATAGGGAAAGTGAACGTGATTGGAAACGTTGTTCTTTTTCTTGGAAAGTTATGTGTTGGTCTTGCGAGTGCTTTGTTTGCATTTCTCATGTTGGATACTCACAGTTATAAATCCGCACACGATAAAGTCTCCT...

CDS

Download CDS FASTA

417 bp · TkA07G040880|TK1151|CDS

ATGATTGCTATCACGGGTGAAGGGTTTTTTGCGGCGTCTGCAACCGCGACTGAATTGATTAAGAACAATATTCTTCGAATAGGGAAAGTGAACGTGATTGGAAACGTTGTTCTTTTTCTTGGAAAGTTATGTGTTGGTCTTGCGAGTGCTTTGTTTGCATTTCTCATGTTGGATACTCACAGTTATAAATCCGCACACGATAAAGTCTCCTCACCGTTAATTCCCGTGCTGGTCTGCTGGGGTCTAGGGTTTGTGGTGGC...

Protein

Download Protein FASTA

138 aa · TkA07G040880|TK1151|PROTEIN

MIAITGEGFFAASATATELIKNNILRIGKVNVIGNVVLFLGKLCVGLASALFAFLMLDTHSYKSAHDKVSSPLIPVLVCWGLGFVVASLFFAVVEVSVDTIILSYCQDSEEHRGTTRYATPLLFETLDEQNEVDTHDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G040880`
TK1151 ID	TkA07G040880
OH-1004 ID	LXL04_027237
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 18.206 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G040880

Location Chr07:10953661-10954566 (-)

Description Similar to CHER1: Choline transporter protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15380`	Regulator of vesicle trafficking, including endocytosis.	CHOLINE TRANSPORTER-LIKE1 is required for sieve plate development to mediate long-distance cell-to-cell communication.2014 · DOI: 10.1038/ncomms5276 Choline transporter-like1 (CHER1) is crucial for plasmodesmata maturation in Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13393

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0009663 plasmodesma organization Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010088 phloem development Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0015031 protein transport Biological Process

GO:0015871 choline transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0034229 ethanolamine transport Biological Process

GO:0048364 root development Biological Process

KEGG gene cross-reference

ath:AT3G15380

xla:432216

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.463

Rank 1 · TkA07G040880 · TK1151

Cell membrane0.259

Rank 2 · TkA07G040880 · TK1151

Cytoplasm0.219

Rank 3 · TkA07G040880 · TK1151

Golgi apparatus0.156

Rank 4 · TkA07G040880 · TK1151

Endoplasmic reticulum0.150

Rank 5 · TkA07G040880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04515Choline_transpo1-110 aa

PF25707UL7813-95 aa

PF26067DUF802418-57 aa

PF26067DUF802470-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G040880	`PF04515`	Choline_transpo	1	110	6.4e-30	105.2
TkA07G040880	`PF25707`	UL78	13	95	0.063	13.2
TkA07G040880	`PF26067`	DUF8024	18	57	1.0	10.0
TkA07G040880	`PF26067`	DUF8024	70	89	1.0	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AN2`	Arabidopsis thaliana	sp\|Q94AN2\|CHER1_ARATH Choline transporter protein 1	70.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card