Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3182 bp · TkA07G040480|TK1151|cDNA
GAACAACTTTCGTCTAAACCTTCGAAAGTTCCCAAATTGAGAGGATTCAGCTCATACCCAGAGGGGATCTTCCCTTCTCCGAACAAATCGTTCAAAAGTCCAACACAAAATCCCAAATTCAAATAAACCCACATCTTACTTTCCTCCAAGTTCCATTTCACAGACTTACTATCCTTCCCAATTTCACATGAGAGTTTCCAATTGAAACATAAAAGATGATCGTGAGGACCTACGGTCGCCGGAGCAGCAGCAACAGCAAC...
2568 bp · TkA07G040480|TK1151|CDS
ATGATCGTGAGGACCTACGGTCGCCGGAGCAGCAGCAACAGCAACAGTAACAGCAGAAGCAGTAACAACAGTCTGACTTTCGACGACGCAGACGGATTCGACGATTCTTTATCTCAAGAAAGCCCTCAAGAATTAGACAACAGCAACAGCGATATCTTCAGTTTCGCTTTTCCATCTCAAGAATCCATCAAGAACCCTTGGTCTTTTGATTCCGACCCATACAGCTTCGATTCTTCCCAGGATTCGCGTAAATTGGCCGT...
Protein
Download Protein FASTA855 aa · TkA07G040480|TK1151|PROTEIN
MIVRTYGRRSSSNSNSNSRSSNNSLTFDDADGFDDSLSQESPQELDNSNSDIFSFAFPSQESIKNPWSFDSDPYSFDSSQDSRKLAVLPPRSKKPKTEANEKRKDKKGKKAKKPLMLLTETTTLMETQEFGEMMEHDDEVNFALDGLRRGQPVRIRRASLLSLLMVCGTLQQRRLLRTHGTAKTIIDAVLGLNFDDTPSNLAAAALFFVLTSDGQDDYLLDSPSSIRFLLKLLKPVTTHAAKSKVTTLGSKLVALSKDTS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G040480 |
|---|---|
| TK1151 ID | TkA07G040480 |
| OH-1004 ID | LXL04_027227 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G040480 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:10817340-10822425 (-) | |||||||||
| Description | Similar to WAPL1: Wings apart-like protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000070 mitotic sister chromatid segregation Biological Process GO:0006281 DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0007059 chromosome segregation Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0010789 meiotic sister chromatid cohesion involved in meiosis I Biological Process GO:0045132 meiotic chromosome segregation Biological Process GO:0045144 meiotic sister chromatid segregation Biological Process GO:0051177 meiotic sister chromatid cohesion Biological Process GO:0051301 cell division Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G11060 ath:AT1G61030 dme:Dmel_CG3707 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07814WAPL123-658 aaPF07814WAPL690-711 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G040480 | PF07814 | WAPL | 123 | 658 | 1.3e-49 | 169.8 |
| TkA07G040480 | PF07814 | WAPL | 690 | 711 | 1.3e-49 | 169.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.