TkA07G040420 | RubberDandelionOmics

Gene overview

TkA07G040420

Reference: TK1151 Chr: Chr07 Coordinates: 10801814-10803419 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1111 bp · TkA07G040420|TK1151|cDNA

CTAAAATCCCAATTGAAGTTCGCCAACCGAAACTAAAGCAACAATGCATCAAATAGTGCACAAGTTTGTTAAAGTCAACGGTGTGCAGCTCCACTTAGCCGAGATCGGAAGCGAGTCGTCGCCGGTGGTTGTGTTTCTCCACGGTTTCCCTGAAATATGGTACAGCTGGCGCCACCAGATGATCGCCGTCGCCAATGCCGGCTATAGAGCTATTGCTCCCGATTCTCGAGGCTACGGCCTCTCAGATCCACCTCCCGTCA...

CDS

Download CDS FASTA

945 bp · TkA07G040420|TK1151|CDS

ATGCATCAAATAGTGCACAAGTTTGTTAAAGTCAACGGTGTGCAGCTCCACTTAGCCGAGATCGGAAGCGAGTCGTCGCCGGTGGTTGTGTTTCTCCACGGTTTCCCTGAAATATGGTACAGCTGGCGCCACCAGATGATCGCCGTCGCCAATGCCGGCTATAGAGCTATTGCTCCCGATTCTCGAGGCTACGGCCTCTCAGATCCACCTCCCGTCACTGAGAAATTCCGATTCTCCGATTTCGTCGACGATCTTCTCGC...

Protein

Download Protein FASTA

314 aa · TkA07G040420|TK1151|PROTEIN

MHQIVHKFVKVNGVQLHLAEIGSESSPVVVFLHGFPEIWYSWRHQMIAVANAGYRAIAPDSRGYGLSDPPPVTEKFRFSDFVDDLLAILDSLGIDKIFLIAKDSGLRTAFLFTLHYPAMVAGVISLGAPHWPLRPASYLTEMPEGFYINRWREPGRAEADFGRFDARTVVRNIYILFSRSEIPIADENQEIMEIVGPPAPLPAWFTEEDLSVYGDLYEKSGVLNPLTITYRTINEGYGIGDLVIKNPMLLILGEKDYFLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G040420`
TK1151 ID	TkA07G040420
OH-1004 ID	LXL04_027224
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 71.854 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G040420`
Location	Chr07:10801814-10803419 (+)
Description	Similar to yfhM: AB hydrolase superfamily protein YfhM (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027224` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	bsu:BSU08590 mtu:Rv3617 mtv:RVBD_3617 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.811

Rank 1 · TkA07G040420 · TK1151

Nucleus0.415

Rank 2 · TkA07G040420 · TK1151

Peroxisome0.070

Rank 3 · TkA07G040420 · TK1151

Mitochondrion0.041

Rank 4 · TkA07G040420 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA07G040420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_426-132 aa

PF00561Abhydrolase_127-256 aa

PF12697Abhydrolase_629-297 aa

PF03472Autoind_bind91-136 aa

PF12146Hydrolase_4244-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G040420	`PF12146`	Hydrolase_4	26	132	1.3e-10	41.8
TkA07G040420	`PF00561`	Abhydrolase_1	27	256	6.3e-26	92.2
TkA07G040420	`PF12697`	Abhydrolase_6	29	297	1.9e-11	45.8
TkA07G040420	`PF03472`	Autoind_bind	91	136	0.19	12.0
TkA07G040420	`PF12146`	Hydrolase_4	244	275	1.3e-10	41.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card