TkA07G022990 | RubberDandelionOmics

Gene overview

TkA07G022990

Reference: TK1151 Chr: Chr07 Coordinates: 6231361-6232698 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1239 bp · TkA07G022990|TK1151|cDNA

CGCATCTTTAAAAACAAACATTCATCTCACAAGATCTTGATCACATTAACTCGACCTTTCATACAATGGTGGAAGATAGTTTAAAGGATTTAAAGAACGGGCTACTGAAAAAAAGAACACACCACCAAAAAGGTCTTCCCTCCTCAAACCCTCAAAATCAAACAAATGTGAACCCACCACCGATCTCAGGACTCCAACTTAGTTTAAAACAAGTCACAATCTTCTTGAGTCTTTACCTAGCCATAGGCACCATCGCCTTT...

CDS

Download CDS FASTA

978 bp · TkA07G022990|TK1151|CDS

ATGGTGGAAGATAGTTTAAAGGATTTAAAGAACGGGCTACTGAAAAAAAGAACACACCACCAAAAAGGTCTTCCCTCCTCAAACCCTCAAAATCAAACAAATGTGAACCCACCACCGATCTCAGGACTCCAACTTAGTTTAAAACAAGTCACAATCTTCTTGAGTCTTTACCTAGCCATAGGCACCATCGCCTTTTTCCTTATTCAAGATCAAATCAGTGGTACAAAAACGAATGGAATCTTGGATTCTATGTATTTTTG...

Protein

Download Protein FASTA

325 aa · TkA07G022990|TK1151|PROTEIN

MVEDSLKDLKNGLLKKRTHHQKGLPSSNPQNQTNVNPPPISGLQLSLKQVTIFLSLYLAIGTIAFFLIQDQISGTKTNGILDSMYFCVVTMTTVGYGDLVPETYFAKILACVFVFIGMGLGGFALSKAADYIVEKEEIMVVKALHIHDGCGLNEIVNEAERYKVKYKFLTVLILIGFLAMIGTMFLTLVENMCFFDAVYCVCATITTLGYGDKSFSSSGGRLFAVFWILTSTVSLAQLFVYLVEIWTESRQRNLVDWVLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G022990`
TK1151 ID	TkA07G022990
OH-1004 ID	LXL04_026987
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G022990

Location Chr07:6231361-6232698 (-)

Description Similar to TPK1: Two-pore potassium channel 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55630`	Voltage-independent, large conductance and potassium- selective tonoplast ion channel.	TPK1 is a vacuolar ion channel different from the slow-vacuolar cation channel.2005 · DOI: 10.1104/pp.105.065599 TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins.2007 · DOI: 10.1111/j.1365-313x.2007.03255.x
`At4g01840`	Probable voltage-independent potassium-selective tonoplast ion channel.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0752300`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
`Os07g0108800`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of protein storage vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
`Os09g0299400`	Inward-rectifying potassium channel.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026987 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010029 regulation of seed germination Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0071257 cellular response to electrical stimulus Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0097623 potassium ion export across plasma membrane Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0031004 potassium ion-transporting ATPase complex Cellular Component

KEGG gene cross-reference

ath:AT4G01840

ath:AT5G55630

dosa:Os03g0752300

dosa:Os07g0108800

dosa:Os09g0299400

osa:4334137

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.378

Rank 1 · TkA07G022990 · TK1151

Cell membrane0.348

Rank 2 · TkA07G022990 · TK1151

Endoplasmic reticulum0.135

Rank 3 · TkA07G022990 · TK1151

Cytoplasm0.132

Rank 4 · TkA07G022990 · TK1151

Golgi apparatus0.099

Rank 5 · TkA07G022990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans51-118 aa

PF07885Ion_trans_252-133 aa

PF26753SIS3_N53-65 aa

PF26753SIS3_N137-254 aa

PF07885Ion_trans_2173-245 aa

PF00520Ion_trans192-240 aa

PF13202EF-hand_5267-283 aa

PF00036EF-hand_1268-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G022990	`PF00520`	Ion_trans	51	118	7.8e-06	26.0
TkA07G022990	`PF07885`	Ion_trans_2	52	133	6.2e-28	97.2
TkA07G022990	`PF26753`	SIS3_N	53	65	3.9	8.0
TkA07G022990	`PF26753`	SIS3_N	137	254	3.9	8.0
TkA07G022990	`PF07885`	Ion_trans_2	173	245	6.2e-28	97.2
TkA07G022990	`PF00520`	Ion_trans	192	240	7.8e-06	26.0
TkA07G022990	`PF13202`	EF-hand_5	267	283	0.077	13.2
TkA07G022990	`PF00036`	EF-hand_1	268	285	0.00026	21.0
TkA07G022990	`PF13499`	EF-hand_7	268	284	0.014	16.5
TkA07G022990	`PF13405`	EF-hand_6	270	283	0.028	14.9
TkA07G022990	`PF00036`	EF-hand_1	304	323	0.00026	21.0
TkA07G022990	`PF13405`	EF-hand_6	304	323	0.028	14.9
TkA07G022990	`PF13499`	EF-hand_7	306	324	0.014	16.5
TkA07G022990	`PF13202`	EF-hand_5	307	320	0.077	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBL1`	Arabidopsis thaliana	sp\|Q8LBL1\|KCO1_ARATH Two-pore potassium channel 1	54.000%	Swiss-Prot	High
`Q9S6Z8`	Arabidopsis thaliana	sp\|Q9S6Z8\|KCO5_ARATH Two-pore potassium channel 5	34.900%	Swiss-Prot	Medium
`Q850M0`	Oryza sativa subsp. japonica	sp\|Q850M0\|KCO1_ORYSJ Two pore potassium channel a	54.000%	Swiss-Prot	High
`Q8LIN5`	Oryza sativa subsp. japonica	sp\|Q8LIN5\|KCO2_ORYSJ Two pore potassium channel b	52.900%	Swiss-Prot	High
`Q69TN4`	Oryza sativa subsp. japonica	sp\|Q69TN4\|KCO3_ORYSJ Two pore potassium channel c	34.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card