TkA07G006600 | RubberDandelionOmics

Gene overview

TkA07G006600

Reference: TK1151 Chr: Chr07 Coordinates: 1842476-1845331 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · TkA07G006600|TK1151|cDNA

TACCGGGATAAGAGTCTCAGAGAGCAAGAACCGATCATGGCAATCACCCATTCCTTCATATCCCATCCGAACTTCCGACTCCACAACCATTTCACACATCACCGATTTACGACTACAACTAGAAGCAGACCCAATTCCATATCTTTAACCACCTGCTCAAGCTCTGATCACACCAATGTATCACTCTTCGAAGCTGCTAAACACACGGTGGATACGTATCTTCAAAGTGGCATGGTGGTTGGATTAGGCTCTGGTGTAGC...

CDS

Download CDS FASTA

882 bp · TkA07G006600|TK1151|CDS

ATGGCAATCACCCATTCCTTCATATCCCATCCGAACTTCCGACTCCACAACCATTTCACACATCACCGATTTACGACTACAACTAGAAGCAGACCCAATTCCATATCTTTAACCACCTGCTCAAGCTCTGATCACACCAATGTATCACTCTTCGAAGCTGCTAAACACACGGTGGATACGTATCTTCAAAGTGGCATGGTGGTTGGATTAGGCTCTGGTGTAGCTTCATCTTTTGCAATTGAGTATTTGGGTCAAAAACT...

Protein

Download Protein FASTA

293 aa · TkA07G006600|TK1151|PROTEIN

MAITHSFISHPNFRLHNHFTHHRFTTTTRSRPNSISLTTCSSSDHTNVSLFEAAKHTVDTYLQSGMVVGLGSGVASSFAIEYLGQKLRVGLLNDIIGIPTCVGSESEAEKAGVPLLQYQDNLQIDFTFNDADIMEEVTLNAIIGRQGEEYLIKKKKILDVTKNLVLMVRENQYKSGVEGSIPVLINSVGWLDTAEEIDDLFVGDAEVWRRASIGHAGPTGGEFPLVTREGHNILDVIFTSPIPNLAEVAKLLDNINGVAC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G006600`
TK1151 ID	TkA07G006600
OH-1004 ID	LXL04_026772
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G006600

Location Chr07:1842476-1845331 (+)

Description Similar to RPI4: Probable ribose-5-phosphate isomerase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44520`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	No verified direct reference in this release
`At2g01290`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	Deficiency in a cytosolic ribose-5-phosphate isomerase causes chloroplast dysfunction, late flowering and premature cell death in Arabidopsis.2009 · DOI: 10.1111/j.1399-3054.2009.01276.x
`At1g71100`	Catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004751 ribose-5-phosphate isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT5G44520

cya:CYA_2325

gox:GOX1708

gvi:gll0030

pfa:PF3D7_0514600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.959

Rank 1 · TkA07G006600 · TK1151

Mitochondrion0.046

Rank 2 · TkA07G006600 · TK1151

Nucleus0.031

Rank 3 · TkA07G006600 · TK1151

Cytoplasm0.027

Rank 4 · TkA07G006600 · TK1151

Cell membrane0.014

Rank 5 · TkA07G006600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22774DNAJC11_beta-barrel31-87 aa

PF06026Rib_5-P_isom_A97-276 aa

PF17577ETM119-173 aa

PF17577ETM272-291 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G006600	`PF22774`	DNAJC11_beta-barrel	31	87	0.019	15.2
TkA07G006600	`PF06026`	Rib_5-P_isom_A	97	276	3.8e-30	105.5
TkA07G006600	`PF17577`	ETM	119	173	0.28	12.5
TkA07G006600	`PF17577`	ETM	272	291	0.28	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI13`	Arabidopsis thaliana	sp\|Q9FI13\|RPI4_ARATH Probable ribose-5-phosphate isomerase 4, chloroplastic	58.000%	Swiss-Prot	High
`Q9ZU38`	Arabidopsis thaliana	sp\|Q9ZU38\|RPI2_ARATH Probable ribose-5-phosphate isomerase 2	30.600%	Swiss-Prot	Medium
`Q9C998`	Arabidopsis thaliana	sp\|Q9C998\|RPI1_ARATH Probable ribose-5-phosphate isomerase 1	27.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card