TkA07G000780 | RubberDandelionOmics

Gene overview

TkA07G000780

Reference: TK1151 Chr: Chr07 Coordinates: 200030-203774 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2166 bp · TkA07G000780|TK1151|cDNA

AAAAATCGTTGAAGAATGAATATATAATACTATCGGATTTGGTGATTAGCCACTTATTTATATACGTACACAAATTTAAATAAATAATAATTGGGTAAATATATATCGCTCCGACCTCCAAAATATCCTCTCTCTCTTTCACTGCTCACTACCCCTTCATCTATTCCAACTCCATGGACCAAGAAAAGTGGGAATGAAACACGGCCAGCAAGGAACAAGCAATTAAGTTGGAGACGATGGAAACAGGATTCGATCCTGAA...

CDS

Download CDS FASTA

1755 bp · TkA07G000780|TK1151|CDS

ATGGAAACAGGATTCGATCCTGAACAAGTGATCCAAGAATTTGAGTGCTTAACCAAAGATGCTAAGAGGGTACAGATCGAAACTTTAAAGAAAATCTTGGAAGAAAATGGTGAAGCAGAGTATTTAAAAAAATGGAATCTTGATGGTAAAACTGACCCCGAAAGATATAGTTCTTGTGTCCCTCTTGTTACCCACAAAGATCTTGAGCCTTTAATTCAACAAATTGCTGATGGGGCACCTCACCCTATTCTCACTGGTAA...

Protein

Download Protein FASTA

584 aa · TkA07G000780|TK1151|PROTEIN

METGFDPEQVIQEFECLTKDAKRVQIETLKKILEENGEAEYLKKWNLDGKTDPERYSSCVPLVTHKDLEPLIQQIADGAPHPILTGKPITTITLSSGTTQGKRKFVPFNDELTETTMQIYRTSFAFRNREFPIGNGKALSFIYGSKQFKTKGGLLAGTATTNVYRSEQFKKTMKAMQTPCCSPDEVIFGPDFHQSLYCHLLCGLVYRDEIQVISSTFAHSIVHSFRSFELFWEELCSDIKTGSLSARITAPSIRTTMAKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G000780`
TK1151 ID	TkA07G000780
OH-1004 ID	LXL04_010763
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.700
Protein coverage (%)	TK1151 99.829 / OH-1004 99.825 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G000780

Location Chr07:200030-203774 (+)

Description Similar to JAR6: Jasmonoyl--L-amino acid synthetase JAR6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46370`	May catalyze conjugation of jasmonic acid to amino acids.	FIN219, an auxin-regulated gene, defines a link between phytochrome A and the downstream regulator COP1 in light control of Arabidopsis development.2000 · DOI: 10.1101/gad.14.15.1958 Jasmonic acid signaling modulates ozone-induced hypersensitive cell death.2000 · DOI: 10.1105/tpc.12.9.1633 Fumonisin B1-induced cell death in arabidopsis protoplasts requires jasmonate-, ethylene-, and salicylate-dependent signaling pathways.2000 · DOI: 10.1105/tpc.12.10.1823 Ozone-sensitive arabidopsis rcd1 mutant reveals opposite roles for ethylene and jasmonate signaling pathways in regulating superoxide-dependent cell death.2000 · DOI: 10.1105/tpc.12.10.1849 Roles of salicylic acid, jasmonic acid, and ethylene in cpr-induced resistance in arabidopsis.2000 · DOI: 10.1105/tpc.12.11.2175 Methyl jasmonate inhibition of root growth and induction of a leaf protein are decreased in an Arabidopsis thaliana mutant.1992 · DOI: 10.1073/pnas.89.15.6837 Jasmonate response locus JAR1 and several related Arabidopsis genes encode enzymes of the firefly luciferase superfamily that show activity on jasmonic, salicylic, and indole-3-acetic acids in an assay for adenylation.2002 · DOI: 10.1105/tpc.000885 Characterization of early, chitin-induced gene expression in Arabidopsis.2002 · DOI: 10.1094/mpmi.2002.15.9.963 An Arabidopsis mutant defective in jasmonate response is allelic to the auxin-signaling mutant axr1.2002 · DOI: 10.1104/pp.005272 Tandemly duplicated Arabidopsis genes that encode polygalacturonase-inhibiting proteins are regulated coordinately by different signal transduction pathways in response to fungal infection.2003 · DOI: 10.1105/tpc.005165 An investigation into the involvement of defense signaling pathways in components of the nonhost resistance of Arabidopsis thaliana to rust fungi also reveals a model system for studying rust fungal compatibility.2003 · DOI: 10.1094/mpmi.2003.16.5.398 Arabidopsis local resistance to Botrytis cinerea involves salicylic acid and camalexin and requires EDS4 and PAD2, but not SID2, EDS5 or PAD4.2003 · DOI: 10.1046/j.1365-313x.2003.01794.x Induced systemic resistance in Arabidopsis thaliana in response to root inoculation with Pseudomonas fluorescens CHA0.2003 · DOI: 10.1094/mpmi.2003.16.10.851 The oxylipin signal jasmonic acid is activated by an enzyme that conjugates it to isoleucine in Arabidopsis.2004 · DOI: 10.1105/tpc.104.023549 Volatile C6-aldehydes and Allo-ocimene activate defense genes and induce resistance against Botrytis cinerea in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci122 Solar ultraviolet-B radiation alters the attractiveness of Arabidopsis plants to diamondback moths (Plutella xylostella L.): impacts on oviposition and involvement of the jasmonic acid pathway.2006 · DOI: 10.1007/s00442-006-0422-3 Glutathione S-transferase interacting with far-red insensitive 219 is involved in phytochrome A-mediated signaling in Arabidopsis.2007 · DOI: 10.1104/pp.106.094185 Rhizobacteria-induced priming in Arabidopsis is dependent on ethylene, jasmonic acid, and NPR1.2007 · DOI: 10.1094/mpmi-20-7-0759 The role of JAR1 in Jasmonoyl-L: -isoleucine production during Arabidopsis wound response.2008 · DOI: 10.1007/s00425-008-0694-4 Ecological modulation of plant defense via phytochrome control of jasmonate sensitivity.2009 · DOI: 10.1073/pnas.0900701106 Enhanced defense responses in Arabidopsis induced by the cell wall protein fractions from Pythium oligandrum require SGT1, RAR1, NPR1 and JAR1.2009 · DOI: 10.1093/pcp/pcp044 A rapid wound signal activates the systemic synthesis of bioactive jasmonates in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03924.x Involvement of salicylate and jasmonate signaling pathways in Arabidopsis interaction with Fusarium graminearum.2010 · DOI: 10.1094/mpmi-23-7-0861 Structural basis of jasmonate-amido synthetase FIN219 in complex with glutathione S-transferase FIP1 during the JA signal regulation.2017 · DOI: 10.1073/pnas.1609980114 A novel signaling pathway controlling induced systemic resistance in Arabidopsis.1998 · DOI: 10.1105/tpc.10.9.1571 Jasmonate signaling mutants of Arabidopsis are susceptible to the soil fungus Pythium irregulare.1998 · DOI: 10.1046/j.1365-313x.1998.00265.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0586200`	Catalyzes the synthesis of jasmonate-amino acid conjugates by adenylation.	Rice JASMONATE RESISTANT 1 is involved in phytochrome and jasmonate signalling.2008 · DOI: 10.1111/j.1365-3040.2008.01790.x OsJAR1 and OsJAR2 are jasmonyl-L-isoleucine synthases involved in wound- and pathogen-induced jasmonic acid signalling.2011 · DOI: 10.1016/j.bbrc.2011.05.055 Response of rice to insect elicitors and the role of OsJAR1 in wound and herbivory-induced JA-Ile accumulation.2013 · DOI: 10.1111/jipb.12057 OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice.2013 · DOI: 10.1271/bbb.130272 Light induces jasmonate-isoleucine conjugation via OsJAR1-dependent and -independent pathways in rice.2014 · DOI: 10.1111/pce.12201 OsJAR1 is required for JA-regulated floret opening and anther dehiscence in rice.2014 · DOI: 10.1007/s11103-014-0212-y
`Os11g0186500`	May catalyze the synthesis of indole-3-acetic acid (IAA)-amino acid conjugates, providing a mechanism for the plant to cope with the presence of excess auxin.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0010046 response to mycotoxin Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT2G46370

dosa:Os05g0586200

nau:109207440

osa:107275638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · TkA07G000780 · TK1151

Nucleus0.430

Rank 2 · TkA07G000780 · TK1151

Mitochondrion0.117

Rank 3 · TkA07G000780 · TK1151

Cell membrane0.058

Rank 4 · TkA07G000780 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA07G000780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03321GH311-319 aa

PF23571GH3_M347-432 aa

PF23572GH3_C447-560 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G000780	`PF03321`	GH3	11	319	5.4e-110	368.0
TkA07G000780	`PF23571`	GH3_M	347	432	4.4e-28	97.9
TkA07G000780	`PF23572`	GH3_C	447	560	7.4e-34	117.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKE2`	Arabidopsis thaliana	sp\|Q9SKE2\|JAR1_ARATH Jasmonoyl--L-amino acid synthetase JAR1	62.900%	Swiss-Prot	High
`Q6I581`	Oryza sativa subsp. japonica	sp\|Q6I581\|GH35_ORYSJ Jasmonoyl--L-amino acid synthetase GH3.5	65.800%	Swiss-Prot	High
`Q53P49`	Oryza sativa subsp. japonica	sp\|Q53P49\|GH312_ORYSJ Probable indole-3-acetic acid-amido synthetase GH3.12	52.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card