Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1809 bp · TkA06G475470|TK1151|cDNA
GGTTTATGTTTATCCCCAAAATTGGATTTACCCTATCGGATCATCTCTGAACTCCTAATTCTTATAAACTGTTCCAAATCTCTTCGCCAAACACACGCACATATGCAATCGGAAGACATTCAACAGATATCATATGAAGAACAACAGCAATAACAATATGGTGGCGGATAAGACACGGGCCCTGCCGGTTGACCCGAATCTCCCACGGTGGGTCTGCCAGAATTGCCGTCACAGTCTCTCCATCACCGGCGTTGATGCTT...
1587 bp · TkA06G475470|TK1151|CDS
ATGAAGAACAACAGCAATAACAATATGGTGGCGGATAAGACACGGGCCCTGCCGGTTGACCCGAATCTCCCACGGTGGGTCTGCCAGAATTGCCGTCACAGTCTCTCCATCACCGGCGTTGATGCTTACCCTGATAAATTCTTCAATGACTCCTCCAGTTACCGATCCGGGATGCAGGGCTCTTCGATGCATGGGGCAAGCAGTGTGTTAGGCACACGAATGGATCAATCGTTTGTTGTATTACCAAAACAAAGGAACCA...
Protein
Download Protein FASTA528 aa · TkA06G475470|TK1151|PROTEIN
MKNNSNNNMVADKTRALPVDPNLPRWVCQNCRHSLSITGVDAYPDKFFNDSSSYRSGMQGSSMHGASSVLGTRMDQSFVVLPKQRNQSSGVPPRPRNGSMNPDSTHSGKAMEESFVVLPPPAASVYKSDPTLDGGGTHFQSHEGGSNSAPTQSNNSGFHSTITVLKRAFEIATTQTQVEQPLCLECMRVLSDKLDKEVEDVNSDIKSYEACLQRLEGEPRNVLSEADFLREKLKIEDEERKLEAAIQETEKQCAEVTGEL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G475470 |
|---|---|
| TK1151 ID | TkA06G475470 |
| OH-1004 ID | LXL04_022575 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.300 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G475470 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr06:117795218-117797879 (-) | ||||||
| Description | Similar to ATG6: Beclin-1-like protein | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0000423 mitophagy Biological Process GO:0006623 protein targeting to vacuole Biological Process GO:0006914 autophagy Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0009846 pollen germination Biological Process GO:0010508 positive regulation of autophagy Biological Process GO:0015031 protein transport Biological Process GO:0032465 regulation of cytokinesis Biological Process GO:0045022 early endosome to late endosome transport Biological Process GO:0045324 late endosome to vacuole transport Biological Process GO:0050832 defense response to fungus Biological Process | ||||||
| KEGG gene cross-reference | ath:AT3G61710 ddi:DDB_G0288021 dre:393846 xla:444178 xtr:619357 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07776zf-AD20-36 aaPF07776zf-AD159-191 aaPF04859DUF641178-241 aaPF17675APG6_N181-309 aaPF27255PM1805187-206 aaPF25764KIF21A_4th191-292 aaPF30882CCDC146_CC_N192-307 aaPF24319DUF7491192-266 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G475470 | PF07776 | zf-AD | 20 | 36 | 0.11 | 13.5 |
| TkA06G475470 | PF07776 | zf-AD | 159 | 191 | 0.11 | 13.5 |
| TkA06G475470 | PF04859 | DUF641 | 178 | 241 | 0.099 | 13.7 |
| TkA06G475470 | PF17675 | APG6_N | 181 | 309 | 2.1e-27 | 96.8 |
| TkA06G475470 | PF27255 | PM1805 | 187 | 206 | 0.005 | 17.8 |
| TkA06G475470 | PF25764 | KIF21A_4th | 191 | 292 | 1.1 | 9.6 |
| TkA06G475470 | PF30882 | CCDC146_CC_N | 192 | 307 | 0.086 | 12.9 |
| TkA06G475470 | PF24319 | DUF7491 | 192 | 266 | 0.92 | 10.5 |
| TkA06G475470 | PF15188 | CCDC-167 | 192 | 220 | 2.6 | 9.1 |
| TkA06G475470 | PF07303 | Occludin_ELL | 193 | 222 | 0.37 | 12.3 |
| TkA06G475470 | PF08286 | Spc24 | 193 | 220 | 1.2 | 10.1 |
| TkA06G475470 | PF27255 | PM1805 | 227 | 290 | 0.005 | 17.8 |
| TkA06G475470 | PF08286 | Spc24 | 230 | 274 | 1.2 | 10.1 |
| TkA06G475470 | PF11225 | DUF3024 | 237 | 277 | 0.039 | 14.9 |
| TkA06G475470 | PF04859 | DUF641 | 240 | 269 | 0.099 | 13.7 |
| TkA06G475470 | PF07303 | Occludin_ELL | 240 | 295 | 0.37 | 12.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9M367 | Arabidopsis thaliana | sp|Q9M367|BECN1_ARATH Beclin-1-like protein | 73.800% | Swiss-Prot | High |