TkA06G468090 | RubberDandelionOmics

Gene overview

TkA06G468090

Reference: TK1151 Chr: Chr06 Coordinates: 115741806-115743194 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · TkA06G468090|TK1151|cDNA

CTTCTCCAATCCGGCCGCGAACACAGGTCTTTCTCTCACCCCGGCGATTTCCGGCGACACTCTACAGGTGCCATTTCCGACGATTTTCCAGCAAGACTCGAAGGCTTCAGCCATTTCCCCACTGTAATTCCACCGTCCCGGCTGCTAGTCGTCCGACGCGAAGCTAAATCTCCAACGTGAAGATAAATCTCACTCATTCTCCGGCTGTCTTCCTCCGACGCGAGGCTGTATTCCTCCGACCTGTATTACTGCTTGTCTTC...

CDS

Download CDS FASTA

321 bp · TkA06G468090|TK1151|CDS

ATGGTGGCAGTTTCGGTTTTGATACTTAGATATGTCCCACCAGATGAGGTCCCACTTCCATCATCACTTCAAGCATCAATAGATTCGGTCTCTTTGCGTTATAGTAATACGGTTAGGTCAGAAGATGTTGATGTTGATGTTGAAGTCAGCAAAAGTCTTGGGGTGGATACATGGATGCGGGTGTTAGTATGGTTGGTGATAGGAGTAGTTGTGTATGTGATATATGGGAGGAATCATAGTGCTCTGCAACACGCAGTTTA...

Protein

Download Protein FASTA

106 aa · TkA06G468090|TK1151|PROTEIN

MVAVSVLILRYVPPDEVPLPSSLQASIDSVSLRYSNTVRSEDVDVDVEVSKSLGVDTWMRVLVWLVIGVVVYVIYGRNHSALQHAVYVPATHVDEIYKSSAESLSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G468090`
TK1151 ID	TkA06G468090
OH-1004 ID	LXL04_022660
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 84.800 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G468090

Location Chr06:115741806-115743194 (-)

Description Similar to CAT2: Cationic amino acid transporter 2, vacuolar

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58030`	Permease involved in the transport of the cationic amino acids.	No verified direct reference in this release
`At5g36940`	Permease involved in the transport of the cationic neutral or acidic amino acids.	Molecular and functional characterization of a family of amino acid transporters from Arabidopsis.2004 · DOI: 10.1104/pp.104.045278
`At3g03720`	Permease involved in the transport of the cationic amino acids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022660 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G58030

ath:AT3G03720

ath:AT5G36940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.468

Rank 1 · TkA06G468090 · TK1151

Nucleus0.289

Rank 2 · TkA06G468090 · TK1151

Golgi apparatus0.173

Rank 3 · TkA06G468090 · TK1151

Cytoplasm0.147

Rank 4 · TkA06G468090 · TK1151

Cell membrane0.077

Rank 5 · TkA06G468090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13906AA_permease_C52-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G468090	`PF13906`	AA_permease_C	52	80	3.1e-09	37.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASS7`	Arabidopsis thaliana	sp\|Q9ASS7\|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar	28.600%	Swiss-Prot	Low
`Q8GYB4`	Arabidopsis thaliana	sp\|Q8GYB4\|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial	54.700%	Swiss-Prot	Medium
`Q8W4K3`	Arabidopsis thaliana	sp\|Q8W4K3\|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar	57.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card