TkA06G452090 | RubberDandelionOmics

Gene overview

TkA06G452090

Reference: TK1151 Chr: Chr06 Coordinates: 111778102-111783001 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4375 bp · TkA06G452090|TK1151|cDNA

GGGACTTTTGTGCTATTTGCCCAAAAAGTAAATGAAATCAACATGAATTCCCTTTTTTGTCAACTCCTGGTGTTACGGTGCGGCCTCAGGGGCTCCGAAGTGGTTCCTCCCCCTCACCAAACATTTGAAAAGTTTCTCACACAAACACCTAATTTCTCGTACAAAATTCACAAAATCCCCCATTTTCTCCTTCCAATTCTTACACCAAAATGGAATCAAGGCGTCAATTGATTGATTCCCTCACCTCCCACATCGCTCTC...

CDS

Download CDS FASTA

2355 bp · TkA06G452090|TK1151|CDS

ATGGTGGTTAATGTAACAACACTTCAAACCACCTCAAAGAAAGCCAAAAGAGCAAAAAAGAAACATAAAAAAAACGGCATAATCGTAAATAACCCCACCAAAACCACCAATTCCCAAACTACCCCTCCTAAACCCGTACCCGAGAATCCAGACGCCAAAATCCCACCAAAAATCATTCCCACTTCCACCAATTCACCACCTCTCGAAAACAGCAATACGGGAAATGAAAACGTAAAAAAAACAACCAAAAAAGAAGAAAA...

Protein

Download Protein FASTA

784 aa · TkA06G452090|TK1151|PROTEIN

MVVNVTTLQTTSKKAKRAKKKHKKNGIIVNNPTKTTNSQTTPPKPVPENPDAKIPPKIIPTSTNSPPLENSNTGNENVKKTTKKEEKKPVVNYGIVNPSRNSPYEWPNNGPQLSFTNSHLPTTTDRLHLDVGHNWQNHYHQPGFLHTVRNRPIENGCTEAIVHPRPIPMSLDWPPMVHSFNGLVPYMPRPQSFKQINQTDDRIYSGEFDSPEFVEEHDSHGHGQWVGEEDFAVSGMDYSQYFGGGVMYWDSSDHPVAGFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G452090`
TK1151 ID	TkA06G452090
OH-1004 ID	LXL04_001985
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	27.600
Protein coverage (%)	TK1151 38.393 / OH-1004 53.411 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G452090`
Location	Chr06:111778102-111783001 (+)
Description	Similar to TENT4B: Terminal nucleotidyltransferase 4B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001985` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006302 double-strand break repair Biological Process GO:0006364 rRNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0006401 RNA catabolic process Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007076 mitotic chromosome condensation Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0010587 miRNA catabolic process Biological Process GO:0031123 RNA 3'-end processing Biological Process GO:0031124 mRNA 3'-end processing Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0033500 carbohydrate homeostasis Biological Process
KEGG gene cross-reference	dme:Dmel_CG11265 hsa:11044 hsa:64282 mmu:210106 mmu:214627 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.481

Rank 1 · TkA06G452090 · TK1151

Cytoplasm0.462

Rank 2 · TkA06G452090 · TK1151

Cell membrane0.088

Rank 3 · TkA06G452090 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA06G452090 · TK1151

Golgi apparatus0.044

Rank 5 · TkA06G452090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03828PAP_assoc2-37 aa

PF22600MTPAP-like_central498-634 aa

PF01909NTP_transf_2500-560 aa

PF18765Polbeta517-541 aa

PF03828PAP_assoc693-746 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G452090	`PF03828`	PAP_assoc	2	37	6.3e-06	27.1
TkA06G452090	`PF22600`	MTPAP-like_central	498	634	1.2e-08	35.8
TkA06G452090	`PF01909`	NTP_transf_2	500	560	5e-06	27.5
TkA06G452090	`PF18765`	Polbeta	517	541	0.14	13.0
TkA06G452090	`PF03828`	PAP_assoc	693	746	6.3e-06	27.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card