TkA06G447430 | RubberDandelionOmics

Gene overview

TkA06G447430

Reference: TK1151 Chr: Chr06 Coordinates: 110558783-110559526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · TkA06G447430|TK1151|cDNA

ATGGAAAACGCTACTCAAGTCAACCTACTCTCATGTTCCTCTTCCACCACCACCACCACCACCACCACCGCCACCTCCACGACGACAATGACAACCACCACCATCTCCACCATTACTCCGATGGCCTGCAACACTCAAAAAGCATCAAAGAGATCTAAAGAGGGAAACAATGGCAATGAGCAAAAGAAACGGAATCATCATCACCCTTCTTATCGAGGTGTAAGAATGAGAAGTTGGGGCAAATGGGTGTCTGAAATTCG...

CDS

Download CDS FASTA

708 bp · TkA06G447430|TK1151|CDS

ATGGAAAACGCTACTCAAGTCAACCTACTCTCATGTTCCTCTTCCACCACCACCACCACCACCACCACCGCCACCTCCACGACGACAATGACAACCACCACCATCTCCACCATTACTCCGATGGCCTGCAACACTCAAAAAGCATCAAAGAGATCTAAAGAGGGAAACAATGGCAATGAGCAAAAGAAACGGAATCATCATCACCCTTCTTATCGAGGTGTAAGAATGAGAAGTTGGGGCAAATGGGTGTCTGAAATTCG...

Protein

Download Protein FASTA

235 aa · TkA06G447430|TK1151|PROTEIN

MENATQVNLLSCSSSTTTTTTTTATSTTTMTTTTISTITPMACNTQKASKRSKEGNNGNEQKKRNHHHPSYRGVRMRSWGKWVSEIREPRKKSRIWLGTFLTAEMAARAHDVAAIAIKGRSAYLNFPDMAHLLPQPATTSTKDIQEAAAKAAASCGGDGHGHGPQQPPSNTTLLSHSDSSITLSSSSDDDTFFQLPDLSLHSTHRTDDLSYYHSSWQLVPEIDDFRLQSEEPYLW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G447430`
TK1151 ID	TkA06G447430
OH-1004 ID	LXL04_022778
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G447430

Location Chr06:110558783-110559526 (+)

Description Similar to ERF034: Ethylene-responsive transcription factor ERF034

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44940`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g16750`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g60490`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g16280`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At2g35700`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022778 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G35700

ath:AT2G44940

ath:AT3G60490

ath:AT4G16750

ath:AT4G32800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA06G447430 · TK1151

Cytoplasm0.093

Rank 2 · TkA06G447430 · TK1151

Cell membrane0.034

Rank 3 · TkA06G447430 · TK1151

Endoplasmic reticulum0.031

Rank 4 · TkA06G447430 · TK1151

Plastid0.019

Rank 5 · TkA06G447430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21827New_glue13-75 aa

PF05086Dicty_REP14-63 aa

PF00847AP269-119 aa

PF00847AP2146-153 aa

PF21827New_glue170-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G447430	`PF21827`	New_glue	13	75	0.0014	19.0
TkA06G447430	`PF05086`	Dicty_REP	14	63	6.1	5.4
TkA06G447430	`PF00847`	AP2	69	119	2.1e-13	51.1
TkA06G447430	`PF00847`	AP2	146	153	2.1e-13	51.1
TkA06G447430	`PF21827`	New_glue	170	170	0.0014	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBQ7`	Arabidopsis thaliana	sp\|Q8LBQ7\|ERF34_ARATH Ethylene-responsive transcription factor ERF034	80.000%	Swiss-Prot	Low
`Q9SUK8`	Arabidopsis thaliana	sp\|Q9SUK8\|ERF39_ARATH Ethylene-responsive transcription factor ERF039	78.800%	Swiss-Prot	Low
`Q9M210`	Arabidopsis thaliana	sp\|Q9M210\|ERF35_ARATH Ethylene-responsive transcription factor ERF035	79.500%	Swiss-Prot	Low
`Q9LU18`	Arabidopsis thaliana	sp\|Q9LU18\|ERF36_ARATH Ethylene-responsive transcription factor ERF036	76.200%	Swiss-Prot	Low
`Q9ZQP3`	Arabidopsis thaliana	sp\|Q9ZQP3\|ERF38_ARATH Ethylene-responsive transcription factor ERF038	77.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card