TkA06G428200 | RubberDandelionOmics

Gene overview

TkA06G428200

Reference: TK1151 Chr: Chr06 Coordinates: 105936658-105939149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · TkA06G428200|TK1151|cDNA

ATGGATTCTTCTCTCTTTTTCAACCAAGAAGACCATGGTAACATTCCTGAGCAATTCATTTGGTCAAAAGATCAAGATGATTCTCATACTACTATTGAAGTGCTAGATGCACCTATAGTAGACTTGCAAGATTTCTTTAAACATGATAAGAAGGCCACATTACATGCTGCCAACCTTGTTAAGAAATCATGCCTAAGCCATGGGTTTTTTCAAGTTGTGAACCACGGCATAGATCCATCATTAGTTGCAATGGCCGATGA...

CDS

Download CDS FASTA

1083 bp · TkA06G428200|TK1151|CDS

ATGGATTCTTCTCTCTTTTTCAACCAAGAAGACCATGGTAACATTCCTGAGCAATTCATTTGGTCAAAAGATCAAGATGATTCTCATACTACTATTGAAGTGCTAGATGCACCTATAGTAGACTTGCAAGATTTCTTTAAACATGATAAGAAGGCCACATTACATGCTGCCAACCTTGTTAAGAAATCATGCCTAAGCCATGGGTTTTTTCAAGTTGTGAACCACGGCATAGATCCATCATTAGTTGCAATGGCCGATGA...

Protein

Download Protein FASTA

360 aa · TkA06G428200|TK1151|PROTEIN

MDSSLFFNQEDHGNIPEQFIWSKDQDDSHTTIEVLDAPIVDLQDFFKHDKKATLHAANLVKKSCLSHGFFQVVNHGIDPSLVAMADEYGRAFFKLPITEKMKYKKKEGSVVGFASAHANRFSKKLPWKEMLSFEYHENGPNEAAVDFFNSVSSRQLKETGLIYQKYCKSMKKLALKIFELLEISLDIDGHKYYGELFEDCISIMRCNYYPRCNQPNLTNGVGPHCDPTTITILYQDEVGGLEVFFDNKWKSVPPHPNALV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G428200`
TK1151 ID	TkA06G428200
OH-1004 ID	LXL04_022915
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.515 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G428200

Location Chr06:105936658-105939149 (+)

Description Similar to GA20OX3: Gibberellin 20 oxidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07200`	May catalyze oxidation reactions in gibberellin biosynthesis.	Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049
`At4g25420`	Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 to GA9, via a three-step oxidation at C-20 of the GA skeleton.	The gibberellin biosynthetic genes AtGA20ox1 and AtGA20ox2 act, partially redundantly, to promote growth and development throughout the Arabidopsis life cycle.2008 · DOI: 10.1111/j.1365-313x.2007.03356.x Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049
`At5g51810`	Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA12 to GA9, via a three-step oxidation at C-20 of the GA skeleton, and GA25 is also formed as a minor product.	The gibberellin biosynthetic genes AtGA20ox1 and AtGA20ox2 act, partially redundantly, to promote growth and development throughout the Arabidopsis life cycle.2008 · DOI: 10.1111/j.1365-313x.2007.03356.x Isolation and expression of three gibberellin 20-oxidase cDNA clones from Arabidopsis.1995 · DOI: 10.1104/pp.108.3.1049

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C5H5`	Key oxidase enzyme in the biosynthesis of gibberellin that catalyzes the conversion of GA53 to GA20 via a three-step oxidation at C-20 of the GA skeleton.	No verified direct reference in this release
`Os01g0883800`	May catalyze oxidation reactions in gibberellin biosynthesis.	Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene.2002 · DOI: 10.1073/pnas.132266399

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022915 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009413 response to flooding Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0048366 leaf development Biological Process

GO:0048575 short-day photoperiodism, flowering Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0045544 gibberellin 20-oxidase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT4G25420

ath:AT5G07200

ath:AT5G51810

dosa:Os01g0883800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.800

Rank 1 · TkA06G428200 · TK1151

Nucleus0.347

Rank 2 · TkA06G428200 · TK1151

Mitochondrion0.046

Rank 3 · TkA06G428200 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA06G428200 · TK1151

Peroxisome0.045

Rank 5 · TkA06G428200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N38-140 aa

PF031712OG-FeII_Oxy65-72 aa

PF031712OG-FeII_Oxy201-299 aa

PF14226DIOX_N322-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G428200	`PF14226`	DIOX_N	38	140	6.4e-23	82.4
TkA06G428200	`PF03171`	2OG-FeII_Oxy	65	72	6.6e-37	126.6
TkA06G428200	`PF03171`	2OG-FeII_Oxy	201	299	6.6e-37	126.6
TkA06G428200	`PF14226`	DIOX_N	322	337	6.4e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39112`	Arabidopsis thaliana	sp\|Q39112\|GAOX3_ARATH Gibberellin 20 oxidase 3	48.600%	Swiss-Prot	Medium
`Q39110`	Arabidopsis thaliana	sp\|Q39110\|GAOX1_ARATH Gibberellin 20 oxidase 1	50.000%	Swiss-Prot	High
`Q39111`	Arabidopsis thaliana	sp\|Q39111\|GAOX2_ARATH Gibberellin 20 oxidase 2	47.200%	Swiss-Prot	Medium
`P0C5H5`	Oryza sativa subsp. indica	sp\|P0C5H5\|GAOX2_ORYSI Gibberellin 20 oxidase 2	49.100%	Swiss-Prot	Medium
`Q0JH50`	Oryza sativa subsp. japonica	sp\|Q0JH50\|GAOX2_ORYSJ Gibberellin 20 oxidase 2	49.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card