TkA06G402800 | RubberDandelionOmics

Gene overview

TkA06G402800

Reference: TK1151 Chr: Chr06 Coordinates: 99713368-99715697 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1536 bp · TkA06G402800|TK1151|cDNA

TACAAGACAAAATAAGCCCCAATTCAAAATTGTTTTTTCAACCAGTGACCCGAGTGTGTGCTCAAAATTGCTTCCTACTTCGCTTCCAGACGTCTCTTTTTTTTATCTTCACCATCATTTCTCCTCTTTCAGGTAATTGCAATATAGTATTGATATTTACCAACTTCAATTTTGTTAATCATATGTTTCCAACATTTACACACAGAACAGTGGAAGAATATCAATGGCCCTAGCCCCGACAACCGGAAACGACGGTGCTG...

CDS

Download CDS FASTA

1044 bp · TkA06G402800|TK1151|CDS

ATGGCCCTAGCCCCGACAACCGGAAACGACGGTGCTGTGTTCAGCGAAGTCGACATGGGTTCTTCCGACTCTTCTTCCGCCACCGTTCGAGCAACTGTTATCCAAGCCTCCACCATCTTCTACGATACCCCTGCTACCCTCGAAAAGGCGGAGAGATTATTATCGGAAGCCGCATCATTTGGGTCCCAATTAGTTGTCTTTCCGGAAGCATTTATAGGCGGATACCCTCGAGGTTCAAATTTTGGTGTCACAATTGGAAG...

Protein

Download Protein FASTA

347 aa · TkA06G402800|TK1151|PROTEIN

MALAPTTGNDGAVFSEVDMGSSDSSSATVRATVIQASTIFYDTPATLEKAERLLSEAASFGSQLVVFPEAFIGGYPRGSNFGVTIGSRTLKGKEDFRKYHASAITVPGPEIDRLGAMAGKYKVFLVMGVIEKDGYTLYCTVLFFDNQGCYLGKHRKLMPTALERVIWGFGDGSTVPVFDTPIGKIGAAICWENKMPLLRTAMYAKGIEIYCAPTADSREVWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYVWSGTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G402800`
TK1151 ID	TkA06G402800
OH-1004 ID	LXL04_023098
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G402800

Location Chr06:99713368-99715697 (-)

Description Similar to NIT4A: Bifunctional nitrilase/nitrile hydratase NIT4A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22300`	Highly specific for beta-cyano-L-alanine (Ala(CN)).	The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.2001 · DOI: 10.1074/jbc.m007890200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019500 cyanide catabolic process Biological Process

GO:0051410 detoxification of nitrogen compound Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0000257 nitrilase activity Molecular Function

GO:0018822 nitrile hydratase activity Molecular Function

GO:0047427 cyanoalanine nitrilase activity Molecular Function

GO:0047558 3-cyanoalanine hydratase activity Molecular Function

KEGG gene cross-reference

dosa:Os02g0635200

lang:109351736

lang:109353638

nta:107804379

nta:107832013

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · TkA06G402800 · TK1151

Nucleus0.353

Rank 2 · TkA06G402800 · TK1151

Cell membrane0.073

Rank 3 · TkA06G402800 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA06G402800 · TK1151

Mitochondrion0.043

Rank 5 · TkA06G402800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00795CN_hydrolase30-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G402800	`PF00795`	CN_hydrolase	30	308	4.7e-64	216.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46011`	Arabidopsis thaliana	sp\|P46011\|NRL4_ARATH Bifunctional nitrilase/nitrile hydratase NIT4	78.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card