TkA06G395670 | RubberDandelionOmics

Gene overview

TkA06G395670

Reference: TK1151 Chr: Chr06 Coordinates: 98034124-98037482 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1406 bp · TkA06G395670|TK1151|cDNA

GAGACTTTCTCCACTTCGTAGGAGACGTGCGAGTGGATTGGGGCTCACAAATCACGAACCAGAAACGCTCGAGAAATTCGGGGTCTTCTCAAATTTCCCACCTTTTTATACCCTTATTTTTCGATTATCCATATGTTCGTTTTTACGATTCTAGGGTTTCATCTTTCGTAGATAACTTTAGCTAGGTTTTTTTAGGAGGTTTGATTTGTTTTTCGTAGCTTCAAACAATATGAGGAAGAAGCTGGATACGCGTTTCCCGG...

CDS

Download CDS FASTA

801 bp · TkA06G395670|TK1151|CDS

ATGAGGAAGAAGCTGGATACGCGTTTCCCGGCCGCTCGAATAAAAAAGATAATGCAAACGGATGAGGATGTTGGGAAGATTGCAATGGCTGTCCCTCTTCTAGTATCTAAAGCTTTGGAACTATTTCTACAAGACCTTTGTGACAGGACATATGAAATCACTCTTCGAAGAGGAGCAAAGACTTTAAACTCTATGCACTTAAAACAATGTGTCCAGAGCTTTAACGTGTTTGACTTTCTGAGAGATATTGTTGGTAAGGT...

Protein

Download Protein FASTA

266 aa · TkA06G395670|TK1151|PROTEIN

MRKKLDTRFPAARIKKIMQTDEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLRRGAKTLNSMHLKQCVQSFNVFDFLRDIVGKVPDLGGSDATGDDRSSSKRRKVADDDHNAGDDDDLKRDKSLHSLNSNGGGRGRGRGRGRGRGRISRAEKESNLAASSLDSDSANKQKPILDSIEDSGSKQNHIHISATGIAEDMVKVRNFDLNLDLDENGDTPAISPPPPLPEPEYPGWSLAEMGGIDPVQLANLNSGVGEDEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G395670`
TK1151 ID	TkA06G395670
OH-1004 ID	LXL04_023130
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.500
Protein coverage (%)	TK1151 99.624 / OH-1004 99.624 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G395670`
Location	Chr06:98034124-98037482 (+)
Description	Similar to DRAP1: Dr1-associated corepressor
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023130` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0017055 negative regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0017054 negative cofactor 2 complex Cellular Component GO:0043596 nuclear replication fork Cellular Component GO:0090575 RNA polymerase II transcription regulator complex Cellular Component GO:0001046 core promoter sequence-specific DNA binding Molecular Function GO:0001091 RNA polymerase II general transcription initiation factor binding Molecular Function GO:0003714 transcription corepressor activity Molecular Function
KEGG gene cross-reference	bta:540345 hsa:10589 mmu:66556 rno:293674 spo:2542201 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.984

Rank 1 · TkA06G395670 · TK1151

Cytoplasm0.081

Rank 2 · TkA06G395670 · TK1151

Cell membrane0.018

Rank 3 · TkA06G395670 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkA06G395670 · TK1151

Plastid0.007

Rank 5 · TkA06G395670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone5-71 aa

PF00808CBFD_NFYB_HMF8-71 aa

PF25698EBNA2_Core132-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G395670	`PF00125`	Histone	5	71	0.0013	19.8
TkA06G395670	`PF00808`	CBFD_NFYB_HMF	8	71	2.6e-19	70.0
TkA06G395670	`PF25698`	EBNA2_Core	132	155	0.0072	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card