TkA06G390230 | RubberDandelionOmics

Gene overview

TkA06G390230

Reference: TK1151 Chr: Chr06 Coordinates: 96703325-96704487 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA06G390230|TK1151|cDNA

TGTTTAATCAATGGTTTAGATCTTCACCAACACCACTTCACACGGATCACCATTACAATTTCACTCGGATCACCCGGAGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCCTCGATCTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCCCTTGCACGCCAGACGATTTCCATCTCTATATTTATCCTCCCGATTTCAAATGGAGATGAAATTGGTTTTCGATTCCATCCCAATTTCACCTCCGACACACA...

CDS

Download CDS FASTA

663 bp · TkA06G390230|TK1151|CDS

TGTTTAATCAATGGTTTAGATCTTCACCAACACCACTTCACACGGATCACCATTACAATTTCACTCGGATCACCCGGAGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCCTCGATCTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCCCTTGCACGCCAGACGATTTCCATCTCTATATTTATCCTCCCGATTTCAAATGGAGATGAAATTGGTTTTCGATTCCATCCCAATTTCACCTCCGACACACA...

Protein

Download Protein FASTA

220 aa · TkA06G390230|TK1151|PROTEIN

CLINGLDLHQHHFTRITITISLGSPGAPFLRHQPRSSPASIFTSSSPRLHADSLARQTISISIFILPISNGDEIGFRFHPNFTSDTHRYGFVLSSTLSSSFHNNHTSIIVAAQISLMHHLDDSTISLPLHRHHHRITLTAPPSHRSGTPSQVCSSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSSLHTTSSTFVYMQTAVLPMVKLPVCYSFYHG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G390230`
TK1151 ID	TkA06G390230
OH-1004 ID	LXL04_028128
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 66.818 / OH-1004 17.626 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G390230

Location Chr06:96703325-96704487 (+)

Description Similar to ISCA: Iron-sulfur assembly protein IscA, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42820`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release
`At1g27650`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0564200`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release
`Os09g0491756`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0030674 protein-macromolecule adaptor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051536 iron-sulfur cluster binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT1G10500

syn:slr1417

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.589

Rank 1 · TkA06G390230 · TK1151

Cytoplasm0.407

Rank 2 · TkA06G390230 · TK1151

Cell membrane0.074

Rank 3 · TkA06G390230 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA06G390230 · TK1151

Mitochondrion0.044

Rank 5 · TkA06G390230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28543DUF843574-120 aa

PF16131Torus166-194 aa

PF25585zf-CCCH_DUS3L168-192 aa

PF00642zf-CCCH169-192 aa

PF18345zf_CCCH_4173-192 aa

PF18044zf-CCCH_4173-188 aa

PF00642zf-CCCH211-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G390230	`PF28543`	DUF8435	74	120	0.32	11.9
TkA06G390230	`PF16131`	Torus	166	194	0.27	12.5
TkA06G390230	`PF25585`	zf-CCCH_DUS3L	168	192	0.029	15.0
TkA06G390230	`PF00642`	zf-CCCH	169	192	5.2e-07	30.1
TkA06G390230	`PF18345`	zf_CCCH_4	173	192	0.0089	16.8
TkA06G390230	`PF18044`	zf-CCCH_4	173	188	0.063	13.8
TkA06G390230	`PF00642`	zf-CCCH	211	218	5.2e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY5`	Arabidopsis thaliana	sp\|Q9FMY5\|U2AFB_ARATH Splicing factor U2af small subunit B	97.300%	Swiss-Prot	Low
`Q9S709`	Arabidopsis thaliana	sp\|Q9S709\|U2AFA_ARATH Splicing factor U2af small subunit A	97.300%	Swiss-Prot	Low
`Q6AUG0`	Oryza sativa subsp. japonica	sp\|Q6AUG0\|U2AFB_ORYSJ Splicing factor U2af small subunit B	85.100%	Swiss-Prot	Low
`Q9ZQW8`	Oryza sativa subsp. japonica	sp\|Q9ZQW8\|U2AFA_ORYSJ Splicing factor U2af small subunit A	90.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card