TkA06G372050 | RubberDandelionOmics

Gene overview

TkA06G372050

Reference: TK1151 Chr: Chr06 Coordinates: 92152667-92155904 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1215 bp · TkA06G372050|TK1151|cDNA

ATGGCTTCCACCACGCTTCATTCACGGTTATCTCACACTCAGTCGCCAGCGGTTACTCGGACCAGTGCCTCTCTTCGCCAGATCACCGGCAATTCGTTGACGTGGAGCCGCGCGTTTGCTCCCGACCGCCTTCTTTCCGCTGTCTCTCATTCTTCTCTTAGAGTTATAGGAGTGAGAGGGTCTGTAAAGCCAATGATTACACGTGCTAGTGGGACAGAACCTGTAGCAGCAGCTAATCTGGCACCAGGAACTCCAGTGAG...

CDS

Download CDS FASTA

1215 bp · TkA06G372050|TK1151|CDS

ATGGCTTCCACCACGCTTCATTCACGGTTATCTCACACTCAGTCGCCAGCGGTTACTCGGACCAGTGCCTCTCTTCGCCAGATCACCGGCAATTCGTTGACGTGGAGCCGCGCGTTTGCTCCCGACCGCCTTCTTTCCGCTGTCTCTCATTCTTCTCTTAGAGTTATAGGAGTGAGAGGGTCTGTAAAGCCAATGATTACACGTGCTAGTGGGACAGAACCTGTAGCAGCAGCTAATCTGGCACCAGGAACTCCAGTGAG...

Protein

Download Protein FASTA

404 aa · TkA06G372050|TK1151|PROTEIN

MASTTLHSRLSHTQSPAVTRTSASLRQITGNSLTWSRAFAPDRLLSAVSHSSLRVIGVRGSVKPMITRASGTEPVAAANLAPGTPVRPTSIMVIGATGTFGRQVVRRALDEGYDVRCLVRPRPAPADFLRDWGATVVQGDLTKPETIPATLVGAHTIIDCATGRLEEPIKTLDWEGKVALIQCAKEMGIQKYVFFSIHNCDKHPEVPLMEIRLTMLSSAYVVSCRYIYIYIYIYIYGLIGQYAVPILEEKSVWGTDAPTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G372050`
TK1151 ID	TkA06G372050
OH-1004 ID	LXL04_019596
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.800
Protein coverage (%)	TK1151 99.010 / OH-1004 88.865 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G372050

Location Chr06:92152667-92155904 (+)

Description Similar to HCF244: Protein HIGH CHLOROPHYLL FLUORESCENCE PHENOTYPE 244, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35250`	Auxiliary factor required, together with HCF173, for the biogenesis of photosystem II (PSII), especially for the synthesis of the reaction center proteins (e.g. D1), via the regulation of the corresponding mRNA (e.g. psbA) translation initiation (ribosomal loading) and stabilization.	ONE-HELIX PROTEIN2 (OHP2) Is Required for the Stability of OHP1 and Assembly Factor HCF244 and Is Functionally Linked to PSII Biogenesis.2018 · DOI: 10.1104/pp.18.00540 OHP1, OHP2, and HCF244 Form a Transient Functional Complex with the Photosystem II Reaction Center.2019 · DOI: 10.1104/pp.18.01231 Exploring the Link between Photosystem II Assembly and Translation of the Chloroplast psbA mRNA.2020 · DOI: 10.3390/plants9020152

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010207 photosystem II assembly Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042651 thylakoid membrane Cellular Component

GO:0003743 translation initiation factor activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G35250

syn:slr0399

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA06G372050 · TK1151

Mitochondrion0.045

Rank 2 · TkA06G372050 · TK1151

Cytoplasm0.018

Rank 3 · TkA06G372050 · TK1151

Nucleus0.017

Rank 4 · TkA06G372050 · TK1151

Cell membrane0.012

Rank 5 · TkA06G372050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16912Glu_dehyd_C84-180 aa

PF05368NmrA90-339 aa

PF01370Epimerase91-196 aa

PF02254TrkA_N91-152 aa

PF00106adh_short91-151 aa

PF010733Beta_HSD92-196 aa

PF13460NAD_binding_1095-214 aa

PF01370Epimerase249-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G372050	`PF16912`	Glu_dehyd_C	84	180	0.0048	17.1
TkA06G372050	`PF05368`	NmrA	90	339	3.9e-23	83.2
TkA06G372050	`PF01370`	Epimerase	91	196	1e-09	38.9
TkA06G372050	`PF02254`	TrkA_N	91	152	0.007	17.4
TkA06G372050	`PF00106`	adh_short	91	151	0.015	15.5
TkA06G372050	`PF01073`	3Beta_HSD	92	196	0.00095	19.0
TkA06G372050	`PF13460`	NAD_binding_10	95	214	3.5e-14	53.8
TkA06G372050	`PF01370`	Epimerase	249	279	1e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65502`	Arabidopsis thaliana	sp\|O65502\|HC244_ARATH Protein HIGH CHLOROPHYLL FLUORESCENCE PHENOTYPE 244, chloroplastic	73.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card