TkA06G350520 | RubberDandelionOmics

Gene overview

TkA06G350520

Reference: TK1151 Chr: Chr06 Coordinates: 87094511-87097172 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

805 bp · TkA06G350520|TK1151|cDNA

CTCTCTTCATCTCACCTCATCTGTAACAAACACCAGAAATCTCTCACCCTAGCCACCTTCCACCGGCTACCCATACCACCTCCGCTTCTTCCGAAATAGAAATCAATCAGGCGTCGATTTTACCCACAAAATACGAGACCACACTCAAACTCATCCATCGATCACTTAAGACTACAAAGATGTGTCGATTCTACCCTGAAAATCTGAGACCACAGTCGCATTAGGGCAATGAGTTTCAAACACAAAAATAACAGATCTTG...

CDS

Download CDS FASTA

348 bp · TkA06G350520|TK1151|CDS

ATGATCGATGATGGGAAGATGGAAGTTGTTAAACAGATTTCATGGAGAAAATGGAGGCCATATACCATGAGAAAGCGGTGGAGAAATGTAGCTTGGGGATTTCGGCTTGTGGATTTGATTCCATTCCATCTGAATTTGGGTTCATGTTCAATTCCAGTCGATGAAACCGTCTGTTCAGTTTTTTGGTCACAACAAGGAATAACTCTTGCAGTCGGTACAAGCAATGGAGAAGTCCACGTTCCCTACTGCATCTTCTTTTG...

Protein

Download Protein FASTA

115 aa · TkA06G350520|TK1151|PROTEIN

MIDDGKMEVVKQISWRKWRPYTMRKRWRNVAWGFRLVDLIPFHLNLGSCSIPVDETVCSVFWSQQGITLAVGTSNGEVHVPYCIFFWKTLKVMARISELTYGCVGAVLEGRLLRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G350520`
TK1151 ID	TkA06G350520
OH-1004 ID	LXL04_025902
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.700
Protein coverage (%)	TK1151 60.870 / OH-1004 19.741 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G350520`
Location	Chr06:87094511-87097172 (-)
Description	Similar to NUF2: Kinetochore protein NUF2 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025902` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000070 mitotic sister chromatid segregation Biological Process GO:0007052 mitotic spindle organization Biological Process GO:0008361 regulation of cell size Biological Process GO:0009624 response to nematode Biological Process GO:0009825 multidimensional cell growth Biological Process GO:0009877 nodulation Biological Process GO:0010091 trichome branching Biological Process GO:0010342 endosperm cellularization Biological Process GO:0010492 maintenance of shoot apical meristem identity Biological Process GO:0016567 protein ubiquitination Biological Process GO:0030154 cell differentiation Biological Process GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process
KEGG gene cross-reference	ath:AT1G61000 ath:AT4G11920 ath:AT4G22910 ath:AT5G13840 mtr:25493638 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.427

Rank 1 · TkA06G350520 · TK1151

Nucleus0.387

Rank 2 · TkA06G350520 · TK1151

Mitochondrion0.136

Rank 3 · TkA06G350520 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA06G350520 · TK1151

Cell membrane0.089

Rank 5 · TkA06G350520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12894ANAPC4_WD407-16 aa

PF24807WD40_CDC20-Fz10-20 aa

PF24506KNTC1_N51-80 aa

PF10886DUF268552-66 aa

PF23381Beta-prop_IFT122_1st53-80 aa

PF24807WD40_CDC20-Fz54-80 aa

PF12894ANAPC4_WD4054-80 aa

PF23389Beta-prop_WDR19_1st54-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G350520	`PF12894`	ANAPC4_WD40	7	16	0.017	16.0
TkA06G350520	`PF24807`	WD40_CDC20-Fz	10	20	0.0061	16.6
TkA06G350520	`PF24506`	KNTC1_N	51	80	0.24	11.4
TkA06G350520	`PF10886`	DUF2685	52	66	0.1	13.8
TkA06G350520	`PF23381`	Beta-prop_IFT122_1st	53	80	0.017	15.2
TkA06G350520	`PF24807`	WD40_CDC20-Fz	54	80	0.0061	16.6
TkA06G350520	`PF12894`	ANAPC4_WD40	54	80	0.017	16.0
TkA06G350520	`PF23389`	Beta-prop_WDR19_1st	54	79	0.11	12.2
TkA06G350520	`PF10886`	DUF2685	69	92	0.1	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card