TkA06G295100 | RubberDandelionOmics

Gene overview

TkA06G295100

Reference: TK1151 Chr: Chr06 Coordinates: 74379192-74381852 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · TkA06G295100|TK1151|cDNA

ATGTATTTCTGGGCTGAGATCATTTGTGGAGGTAATGTAGGTGAACTGAAAGCTGTTCTATCCAACAAAGAATACCAAATTATTTCCGAATGTGCACTGTCCAACATCTCAGAGACTCAAAATAATATCCCCCTTTTAAACAACGGATCCGTGTCAGCTTCTGCTGATGTTATTGACGCTTCACAAGGTCATGAACATGAAGCTGAAAATCAGTCAATGGGTCTTGGCTGTGTGCCATATTTGCCAAAGGTTCTACCCGA...

CDS

Download CDS FASTA

825 bp · TkA06G295100|TK1151|CDS

ATGTATTTCTGGGCTGAGATCATTTGTGGAGGTAATGTAGGTGAACTGAAAGCTGTTCTATCCAACAAAGAATACCAAATTATTTCCGAATGTGCACTGTCCAACATCTCAGAGACTCAAAATAATATCCCCCTTTTAAACAACGGATCCGTGTCAGCTTCTGCTGATGTTATTGACGCTTCACAAGGTCATGAACATGAAGCTGAAAATCAGTCAATGGGTCTTGGCTGTGTGCCATATTTGCCAAAGGTTCTACCCGA...

Protein

Download Protein FASTA

274 aa · TkA06G295100|TK1151|PROTEIN

MYFWAEIICGGNVGELKAVLSNKEYQIISECALSNISETQNNIPLLNNGSVSASADVIDASQGHEHEAENQSMGLGCVPYLPKVLPDFFHTIRTCEDTLKKFTTWKLGTLISIVRQHILKYLPELLSLIAQLWSSFSLPTANRSVVTVLFIPAICWTRAVCSRAEFMEDDEKCRAFAKALHYKEMEFEGALSKKMDANPVAVVEALIHINNQLHQHELYSRHRECCRTGHGQVGSRLGGKWDQSFETLNAKVTGLRLKEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G295100`
TK1151 ID	TkA06G295100
OH-1004 ID	LXL04_003698
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.100
Protein coverage (%)	TK1151 60.219 / OH-1004 72.414 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G295100

Location Chr06:74379192-74381852 (-)

Description Similar to TOR: Serine/threonine-protein kinase TOR

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50030`	Essential cell growth regulator that controls development from early embryo to seed production.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0235300`	Component of TORC1 complex, which is an essential cell growth regulator that controls plant development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003698 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009303 rRNA transcription Biological Process

GO:0009615 response to virus Biological Process

GO:0009630 gravitropism Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009745 sucrose mediated signaling Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G50030

dosa:Os05g0235300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.465

Rank 1 · TkA06G295100 · TK1151

Cytoplasm0.436

Rank 2 · TkA06G295100 · TK1151

Mitochondrion0.096

Rank 3 · TkA06G295100 · TK1151

Cell membrane0.075

Rank 4 · TkA06G295100 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA06G295100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11865mTOR_dom71-115 aa

PF11865mTOR_dom192-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G295100	`PF11865`	mTOR_dom	71	115	7.3e-11	43.0
TkA06G295100	`PF11865`	mTOR_dom	192	212	7.3e-11	43.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FR53`	Arabidopsis thaliana	sp\|Q9FR53\|TOR_ARATH Serine/threonine-protein kinase TOR	75.400%	Swiss-Prot	Low
`Q0DJS1`	Oryza sativa subsp. japonica	sp\|Q0DJS1\|TOR_ORYSJ Serine/threonine-protein kinase TOR	61.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card