TkA06G164760 | RubberDandelionOmics

Gene overview

TkA06G164760

Reference: TK1151 Chr: Chr06 Coordinates: 43400432-43402656 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1293 bp · TkA06G164760|TK1151|cDNA

ATTAGAAAAAGCATCAAGCTAGGGCTTTTCAGTGACCCGTACAGTTGGACCGTATCCGAATTCTCCGGTCATATCGGAATTTAGACGACCAAATTCCTCCGCCGTACCGACTTTTATCGCCGCCGACCTCGCTGCGAAACCGGCTTCAACTCCCTCTCTCTCGTCGCTCAATCAGCAGAAGGAATTGGAGCTGATGGTAAGGGATGTGAAGAATCACCATCCAGAAGAAGAAGAGGATGAGGAGGATTTCATTTCGAGAA...

CDS

Download CDS FASTA

909 bp · TkA06G164760|TK1151|CDS

ATGGTAAGGGATGTGAAGAATCACCATCCAGAAGAAGAAGAGGATGAGGAGGATTTCATTTCGAGAACAACTGACGGTTCCTCACAGAAAGATGGAAGGAGGAACGATCAGAAGGCCGGCTCTCATCGTTCTAAGCATTCCGAGACAGAACAGCGTCGAAGGAGTAAAATCAACGAGAGATTTCAGATTCTGAGAGACCTCATCCCTCAAAATGATCAGAAAAGAGACAGAGCTTCTTTCTTGTTAGAGGTCATTCAATA...

Protein

Download Protein FASTA

302 aa · TkA06G164760|TK1151|PROTEIN

MVRDVKNHHPEEEEDEEDFISRTTDGSSQKDGRRNDQKAGSHRSKHSETEQRRRSKINERFQILRDLIPQNDQKRDRASFLLEVIQYIQFLQEKLQLYEGTYHGWSPEPTKLMPWRGNGGTDTFTDQSHPIKNGSVDEGNIVFPPALLSNTQTLVDPELSAAFTTPESFSNLLNSQSRLQQPPWIDRHHLNENAVQSYSGNEFEDLKMQTEEDRDRDSVISDAYSKGLLSNLTQALGSCGVDLSQASISVQFDIRKGTSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G164760`
TK1151 ID	TkA06G164760
OH-1004 ID	LXL04_024204
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.300
Protein coverage (%)	TK1151 100.000 / OH-1004 79.577 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G164760

Location Chr06:43400432-43402656 (+)

Description Similar to BIM2: Transcription factor BIM2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69010`	Positive brassinosteroid-signaling protein.	No verified direct reference in this release
`At5g08130`	Positive brassinosteroid-signaling protein.	A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.2005 · DOI: 10.1016/j.cell.2004.11.044
`At5g38860`	Positive brassinosteroid-signaling protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:1902448 positive regulation of shade avoidance Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G69010

ath:AT5G08130

ath:AT5G38860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA06G164760 · TK1151

Cytoplasm0.106

Rank 2 · TkA06G164760 · TK1151

Cell membrane0.023

Rank 3 · TkA06G164760 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA06G164760 · TK1151

Plastid0.009

Rank 5 · TkA06G164760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23183bHLH_NPAS422-30 aa

PF00010HLH43-92 aa

PF23177bHLH_IRO344-96 aa

PF23173bHLH_SAC5150-94 aa

PF23183bHLH_NPAS451-81 aa

PF12451VPS11_C198-230 aa

PF23177bHLH_IRO3205-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G164760	`PF23183`	bHLH_NPAS4	22	30	0.0047	17.6
TkA06G164760	`PF00010`	HLH	43	92	1.5e-15	57.4
TkA06G164760	`PF23177`	bHLH_IRO3	44	96	0.00033	21.7
TkA06G164760	`PF23173`	bHLH_SAC51	50	94	0.0089	16.6
TkA06G164760	`PF23183`	bHLH_NPAS4	51	81	0.0047	17.6
TkA06G164760	`PF12451`	VPS11_C	198	230	0.11	13.4
TkA06G164760	`PF23177`	bHLH_IRO3	205	218	0.00033	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAA4`	Arabidopsis thaliana	sp\|Q9CAA4\|BIM2_ARATH Transcription factor BIM2	45.700%	Swiss-Prot	Medium
`Q9LEZ3`	Arabidopsis thaliana	sp\|Q9LEZ3\|BIM1_ARATH Transcription factor BIM1	40.800%	Swiss-Prot	Medium
`Q9FMB6`	Arabidopsis thaliana	sp\|Q9FMB6\|BIM3_ARATH Transcription factor BIM3	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card