TkA06G152870 | RubberDandelionOmics

Gene overview

TkA06G152870

Reference: TK1151 Chr: Chr06 Coordinates: 40006032-40006427 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · TkA06G152870|TK1151|cDNA

ATGAGGAAGTGGGGGAAGTGGGTGGCTGAGATTAGGGAGCCGAATAAAAGGTCGAGGATTTGGTTGGGGTCGTACTCGACTCCAGTCGCGGCGGCGAGAGCTTACGACACCGCCGTGTACTACCTCCGTGGTCCATCGGCGCGGCTCAATTTCCCGGAATTATTGGGTTCCGACGGCGGTCTTGACGAGCTGTCCGCCGCCTCCATTAGGAAAAAAGCGATCGAAGTTGGGGCGAGAGTGGACGCAGAAACGAGTTGTAC...

CDS

Download CDS FASTA

357 bp · TkA06G152870|TK1151|CDS

ATGAGGAAGTGGGGGAAGTGGGTGGCTGAGATTAGGGAGCCGAATAAAAGGTCGAGGATTTGGTTGGGGTCGTACTCGACTCCAGTCGCGGCGGCGAGAGCTTACGACACCGCCGTGTACTACCTCCGTGGTCCATCGGCGCGGCTCAATTTCCCGGAATTATTGGGTTCCGACGGCGGTCTTGACGAGCTGTCCGCCGCCTCCATTAGGAAAAAAGCGATCGAAGTTGGGGCGAGAGTGGACGCAGAAACGAGTTGTAC...

Protein

Download Protein FASTA

118 aa · TkA06G152870|TK1151|PROTEIN

MRKWGKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPSARLNFPELLGSDGGLDELSAASIRKKAIEVGARVDAETSCTSLDTSVKPCWFQEKPDLNLKPEPEDPDRDYW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G152870`
TK1151 ID	TkA06G152870
OH-1004 ID	LXL04_024356
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.300
Protein coverage (%)	TK1151 100.000 / OH-1004 77.059 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G152870

Location Chr06:40006032-40006427 (+)

Description Similar to ERF008: Ethylene-responsive transcription factor ERF008

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23340`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g67190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g50260`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g06746`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g46768`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024356 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071502 cellular response to temperature stimulus Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G23340

ath:AT3G50260

ath:AT4G06746

ath:AT4G36900

ath:AT5G67190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.742

Rank 1 · TkA06G152870 · TK1151

Cytoplasm0.222

Rank 2 · TkA06G152870 · TK1151

Plastid0.058

Rank 3 · TkA06G152870 · TK1151

Cell membrane0.054

Rank 4 · TkA06G152870 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA06G152870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP22-44 aa

PF20858Pgp3_N8-32 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G152870	`PF00847`	AP2	2	44	9.5e-10	39.3
TkA06G152870	`PF20858`	Pgp3_N	8	32	0.054	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22174`	Arabidopsis thaliana	sp\|O22174\|ERF08_ARATH Ethylene-responsive transcription factor ERF008	58.700%	Swiss-Prot	High
`Q9FH94`	Arabidopsis thaliana	sp\|Q9FH94\|ERF10_ARATH Ethylene-responsive transcription factor ERF010	81.900%	Swiss-Prot	Medium
`Q9SNE1`	Arabidopsis thaliana	sp\|Q9SNE1\|ERF11_ARATH Ethylene-responsive transcription factor ERF011	60.300%	Swiss-Prot	High
`Q8W3M3`	Arabidopsis thaliana	sp\|Q8W3M3\|RAP29_ARATH Ethylene-responsive transcription factor RAP2-9	77.300%	Swiss-Prot	High
`Q8LC30`	Arabidopsis thaliana	sp\|Q8LC30\|RAP21_ARATH Ethylene-responsive transcription factor RAP2-1	62.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card