TkA06G152130 | RubberDandelionOmics

Gene overview

TkA06G152130

Reference: TK1151 Chr: Chr06 Coordinates: 39832779-39834846 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1607 bp · TkA06G152130|TK1151|cDNA

TACATTTTTTTTTAGCATACGTCGGTAAAATGATGTGACGGTGTTGGTCTATTTATAGCCAACGGGATCCCTTTTTACGTTCTCACATCCCTATTCTTTTCTCCTTCATAACAACAATGGCGACTGCTGCAACTACGTATGCCCTTCTCTTCTGTCTCCTGTTCTCTCAGACGTATGCAACAAGTAACATCTCCGTCGACCACGACGGCGAAGTACGTGTAGAGAACTCGCCACCTACTCGGACAGAGGAGGAGATCAGG...

CDS

Download CDS FASTA

1155 bp · TkA06G152130|TK1151|CDS

ATGGCGACTGCTGCAACTACGTATGCCCTTCTCTTCTGTCTCCTGTTCTCTCAGACGTATGCAACAAGTAACATCTCCGTCGACCACGACGGCGAAGTACGTGTAGAGAACTCGCCACCTACTCGGACAGAGGAGGAGATCAGGAGTGCGTATGAGTTGTGGCTGGTAAGCCATGGGAAAGCGTATAATGGGTTAGGAGAGAAGGAGAAGAGGTTTCAGATCTTCAAGGATAATCTGAGGTTTATCGACGAACATAATTC...

Protein

Download Protein FASTA

384 aa · TkA06G152130|TK1151|PROTEIN

MATAATTYALLFCLLFSQTYATSNISVDHDGEVRVENSPPTRTEEEIRSAYELWLVSHGKAYNGLGEKEKRFQIFKDNLRFIDEHNSSGNRTYKVGLNRFADVTNEEYRSMYLGTRADANRRIAKLQRGEISRRYAVQDNEMLPVEVDWRRSGAVAPIKNQGSCGSCWAFSTVAAVEGINKIVTGDLISLSEQELVDCDNKYNSGCNGGTMDYAFEFIVANGGIDTESDYPYKGVGNTCDPIRNKAKIVTIDGYEDVPPM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G152130`
TK1151 ID	TkA06G152130
OH-1004 ID	LXL04_024365
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G152130

Location Chr06:39832779-39834846 (-)

Description Similar to RD21A: Cysteine proteinase RD21A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47128`	Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable).	No verified direct reference in this release
`At5g43060`	Probable thiol protease.	No verified direct reference in this release
`At4g36880`	Probable thiol protease.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0650000`	Oryzain alpha chain.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024365 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000932 P-body Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G47128

ath:AT3G19390

ath:AT5G43060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.549

Rank 1 · TkA06G152130 · TK1151

Extracellular0.175

Rank 2 · TkA06G152130 · TK1151

Cytoplasm0.148

Rank 3 · TkA06G152130 · TK1151

Cell membrane0.109

Rank 4 · TkA06G152130 · TK1151

Endoplasmic reticulum0.108

Rank 5 · TkA06G152130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246Inhibitor_I2951-108 aa

PF00112Peptidase_C1143-359 aa

PF03051Peptidase_C1_2152-175 aa

PF03051Peptidase_C1_2300-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G152130	`PF08246`	Inhibitor_I29	51	108	1.6e-20	73.9
TkA06G152130	`PF00112`	Peptidase_C1	143	359	6.3e-84	282.2
TkA06G152130	`PF03051`	Peptidase_C1_2	152	175	5.1e-06	26.3
TkA06G152130	`PF03051`	Peptidase_C1_2	300	340	5.1e-06	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43297`	Arabidopsis thaliana	sp\|P43297\|RD21A_ARATH Cysteine proteinase RD21A	60.700%	Swiss-Prot	High
`Q9FMH8`	Arabidopsis thaliana	sp\|Q9FMH8\|RD21B_ARATH Probable cysteine protease RD21B	63.300%	Swiss-Prot	High
`Q94B08`	Arabidopsis thaliana	sp\|Q94B08\|RDL1_ARATH Germination-specific cysteine protease 1	58.400%	Swiss-Prot	High
`P25776`	Oryza sativa subsp. japonica	sp\|P25776\|ORYA_ORYSJ Oryzain alpha chain	64.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card