Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1178 bp · TkA06G129120|TK1151|cDNA
TTTCACTCGGATCAGGTTACTACATCCCTCGGATCAATGACTCACCCATACCAGCGAGGCGCATGCTTCCGACACCACCATACCTCGTGGATTTCCCTTGCGCCTTCTCCGATTCCCTTGCACGCCCTTCTCTCCCAAGCGGCCGCCATCGTACAAGACACCATACCTTCCCCACCCATACCTCTATCTTCATAGCTAAGAGGAAAATGGGCGCGATCTTCAAATTTCCCTCTCTATATTTACCCTCCCGTAATTGCTAT...
366 bp · TkA06G129120|TK1151|CDS
ATGAAGGTGATCAGATCGGTCAAGGGTTTGATAACGGCACGAGATTCTATTGCACAGCTACCATATTTTTGCTTCAGCCATTGGAGTCGACCACAAGGGGCTACTGTCATTGGGATTAATGAACCAACGTCTTTGGTGGACTTCATTTCTGGAATCAGATCTAATGCAAGCTACCAAGGGCAATTTCGGAAAGTTGTCGCTGTTTGGGGCCGGTTTCATGAAAAGTTGCAGTTTCCTCTGCAAATCAGGCATTTTCGTCA...
Protein
Download Protein FASTA121 aa · TkA06G129120|TK1151|PROTEIN
MKVIRSVKGLITARDSIAQLPYFCFSHWSRPQGATVIGINEPTSLVDFISGIRSNASYQGQFRKVVAVWGRFHEKLQFPLQIRHFRQDWQLLWSYSVIYYRGWGKICYFLRYRRKVIIILW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G129120 |
|---|---|
| TK1151 ID | TkA06G129120 |
| OH-1004 ID | LXL04_020262 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.300 |
| Protein coverage (%) | TK1151 43.802 / OH-1004 11.964Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G129120 |
|---|---|
| Location | Chr06:33726479-33728870 (-) |
| Description | Similar to LIG1: DNA ligase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000012 single strand break repair Biological Process GO:0006260 DNA replication Biological Process GO:0006273 lagging strand elongation Biological Process GO:0006281 DNA repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006287 base-excision repair, gap-filling Biological Process GO:0006298 mismatch repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006303 double-strand break repair via nonhomologous end joining Biological Process GO:0006310 DNA recombination Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0032201 telomere maintenance via semi-conservative replication Biological Process |
| KEGG gene cross-reference | ath:AT1G08130 hsa:3978 mmu:16881 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.