TkA06G108730 | RubberDandelionOmics

Gene overview

TkA06G108730

Reference: TK1151 Chr: Chr06 Coordinates: 28623060-28625737 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1884 bp · TkA06G108730|TK1151|cDNA

TAAATGCACTGTATAAACATCCGGGAAAATGAGGTAAAAGGGTTTAAGAAAATCTCCGGCGAGCTGTTACACACAATGGACGCCACCGACGAGCATAATCACTATACCGCCAAGAGAAAGCGAGACAGCAATGAAGACGGCGAGGATTCCCCAGCCGTTGCAAACGGTGGCGTGGACCTTTCGTTGTTAGAAGAAATCGAGAAGTCACAGCACTCCGTTGAAGTTCTCGATGTTAAAACCCTAAAGAAACTCGTTCTCTC...

CDS

Download CDS FASTA

1662 bp · TkA06G108730|TK1151|CDS

ATGCACTGTATAAACATCCGGGAAAATGAGGTAAAAGGGTTTAAGAAAATCTCCGGCGAGCTGTTACACACAATGGACGCCACCGACGAGCATAATCACTATACCGCCAAGAGAAAGCGAGACAGCAATGAAGACGGCGAGGATTCCCCAGCCGTTGCAAACGGTGGCGTGGACCTTTCGTTGTTAGAAGAAATCGAGAAGTCACAGCACTCCGTTGAAGTTCTCGATGTTAAAACCCTAAAGAAACTCGTTCTCTCCTT...

Protein

Download Protein FASTA

553 aa · TkA06G108730|TK1151|PROTEIN

MHCINIRENEVKGFKKISGELLHTMDATDEHNHYTAKRKRDSNEDGEDSPAVANGGVDLSLLEEIEKSQHSVEVLDVKTLKKLVLSFERRLRDNIAARLKYPDQPEKFADSEIELHEEIEKLKILAGAPELYPDLVNLNTIPAILDLLTHDNTDIAIDVVGLLQDLTDEDVLDENDEPARILVDCLIENNVLESLLQNLLRLSETDPDEVAAIYSTLTTIENLIEVKPAVAEMVCERTKLLRWIIGKIKVREFDSNKQYA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G108730`
TK1151 ID	TkA06G108730
OH-1004 ID	LXL04_024787
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G108730`
Location	Chr06:28623060-28625737 (+)
Description	Similar to Ctnnbl1: Beta-catenin-like protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024787` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0000974 Prp19 complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	bta:282421 hsa:56259 mmu:66642 rno:296320 spo:2542555 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.905

Rank 1 · TkA06G108730 · TK1151

Cytoplasm0.207

Rank 2 · TkA06G108730 · TK1151

Mitochondrion0.022

Rank 3 · TkA06G108730 · TK1151

Cell membrane0.021

Rank 4 · TkA06G108730 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA06G108730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08216CTNNBL62-524 aa

PF24768ARM_ARMC5121-168 aa

PF00514Arm135-167 aa

PF00514Arm184-199 aa

PF24768ARM_ARMC5187-347 aa

PF08519RFC1373-407 aa

PF08519RFC1486-546 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G108730	`PF08216`	CTNNBL	62	524	3.4e-167	557.4
TkA06G108730	`PF24768`	ARM_ARMC5	121	168	4.6e-05	23.7
TkA06G108730	`PF00514`	Arm	135	167	0.026	15.3
TkA06G108730	`PF00514`	Arm	184	199	0.026	15.3
TkA06G108730	`PF24768`	ARM_ARMC5	187	347	4.6e-05	23.7
TkA06G108730	`PF08519`	RFC1	373	407	0.18	12.6
TkA06G108730	`PF08519`	RFC1	486	546	0.18	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card