TkA06G105830 | RubberDandelionOmics

Gene overview

TkA06G105830

Reference: TK1151 Chr: Chr06 Coordinates: 27989655-27991352 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1265 bp · TkA06G105830|TK1151|cDNA

TTTCATAAACAAACAAATTTCAGTTGCCACTTTAAGCAATATAATAATACTTCATTGGAGAATAAACCCAAGTTACACTACAAAAACACCCCACTTCCCTCGCCGTCACTTTGAATCATGAGAGCCCACCGACCTCCAACTTCGCCCCTGCCTTTACTTCTCCTTCTCGTTCTTAAGATTCTCCATCTTTCTTCTCAACATTCTCTCTCCACAAGATGTTGTCATGGACACCGTTCTTACTAACATTCGCCAACTTCTTA...

CDS

Download CDS FASTA

795 bp · TkA06G105830|TK1151|CDS

ATGTTGTCATGGACACCGTTCTTACTAACATTCGCCAACTTCTTACTCACAGCTTCTGCTCACTATCACTACTCCCCAACATCACCTTCCCCGTCATCGCCGTCGTTGCCGGAGTGGAAATCCGCCAGGGCGACGTATTACGCTGAAGCTGACCCCCGTGACGCGGTCGGTGGAGCTTGTGGGTATGGTGACCTGGAGCAGGGTGGGTATGGGAAAGCGACAGCTGGATTGAGCAGTGTGCTGTTCGAAAAGGGACAGAT...

Protein

Download Protein FASTA

264 aa · TkA06G105830|TK1151|PROTEIN

MLSWTPFLLTFANFLLTASAHYHYSPTSPSPSSPSLPEWKSARATYYAEADPRDAVGGACGYGDLEQGGYGKATAGLSSVLFEKGQICGACFQVRCVEDLRWCIPGTSIIVTATNFCAPNYGFPADGGGKCNPPNPHFVLPIEIFEKIAIWKASNMPIQYRRIKCRKDGGLRFTINGNGIFLSVLISNVGGAGDIMAVKIKGSRTGWLPMNRNWGQNWHLNADLKNQPLSFEITSSDGLTLTSYNVAPKDWDFGQSFEGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G105830`
TK1151 ID	TkA06G105830
OH-1004 ID	LXL04_013957
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 92.045 / OH-1004 88.192 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G105830

Location Chr06:27989655-27991352 (+)

Description Similar to EXPA13: Expansin-A13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03220`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At3g55500`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`At5g56320`	Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	LBD18 acts as a transcriptional activator that directly binds to the EXPANSIN14 promoter in promoting lateral root emergence of Arabidopsis.2013 · DOI: 10.1111/tpj.12013

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0583500`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release
`Os03g0822000`	May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013957 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006949 syncytium formation Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010311 lateral root formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G03220

ath:AT3G55500

ath:AT5G56320

dosa:Os01g0823100

dosa:Os04g0583500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.400

Rank 1 · TkA06G105830 · TK1151

Lysosome / Vacuole0.214

Rank 2 · TkA06G105830 · TK1151

Cytoplasm0.101

Rank 3 · TkA06G105830 · TK1151

Endoplasmic reticulum0.092

Rank 4 · TkA06G105830 · TK1151

Plastid0.081

Rank 5 · TkA06G105830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22514EXPB1_D144-118 aa

PF29515Expansin_N55-149 aa

PF03330DPBB_175-160 aa

PF01357Expansin_C172-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G105830	`PF22514`	EXPB1_D1	44	118	0.00056	21.0
TkA06G105830	`PF29515`	Expansin_N	55	149	1e-08	36.1
TkA06G105830	`PF03330`	DPBB_1	75	160	3.9e-15	56.6
TkA06G105830	`PF01357`	Expansin_C	172	248	4.4e-29	101.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9P0`	Arabidopsis thaliana	sp\|Q9M9P0\|EXP13_ARATH Expansin-A13	72.500%	Swiss-Prot	High
`Q9M2S9`	Arabidopsis thaliana	sp\|Q9M2S9\|EXP16_ARATH Expansin-A16	56.900%	Swiss-Prot	High
`Q9FMA0`	Arabidopsis thaliana	sp\|Q9FMA0\|EXP14_ARATH Expansin-A14	56.700%	Swiss-Prot	High
`Q7XUD0`	Oryza sativa subsp. japonica	sp\|Q7XUD0\|EXP10_ORYSJ Expansin-A10	65.100%	Swiss-Prot	High
`Q852A1`	Oryza sativa subsp. japonica	sp\|Q852A1\|EXPA7_ORYSJ Expansin-A7	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card