TkA06G104080 | RubberDandelionOmics

Gene overview

TkA06G104080

Reference: TK1151 Chr: Chr06 Coordinates: 27599440-27603348 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1941 bp · TkA06G104080|TK1151|cDNA

ATGGCCAGGTGGTGGTTCTCTGGGTGGCTGGCGGTGGTGGTGTGCTTTCTCCACATAATATTTCTCACAACTCCAGTGACATCTCAGCCACAAGTTAACTTACTACTTAGATCATGCAGCTTACAGAACACAAGGACTTCCTTTAAAAGTCTTAATGAGACTTTTACGGGGGTGAGAAGACTATTATCCAACAATAACACATACTTCGCTACCGGTGAGCAGACTCGAAGCTCGGAACCCATCTACATGATGGCACAGTG...

CDS

Download CDS FASTA

1941 bp · TkA06G104080|TK1151|CDS

ATGGCCAGGTGGTGGTTCTCTGGGTGGCTGGCGGTGGTGGTGTGCTTTCTCCACATAATATTTCTCACAACTCCAGTGACATCTCAGCCACAAGTTAACTTACTACTTAGATCATGCAGCTTACAGAACACAAGGACTTCCTTTAAAAGTCTTAATGAGACTTTTACGGGGGTGAGAAGACTATTATCCAACAATAACACATACTTCGCTACCGGTGAGCAGACTCGAAGCTCGGAACCCATCTACATGATGGCACAGTG...

Protein

Download Protein FASTA

646 aa · TkA06G104080|TK1151|PROTEIN

MARWWFSGWLAVVVCFLHIIFLTTPVTSQPQVNLLLRSCSLQNTRTSFKSLNETFTGVRRLLSNNNTYFATGEQTRSSEPIYMMAQCRLYMSTVDCLACYDVATTYIRACGAATGARAVLDGCFLRYDPTRFYDEATQPGNVAYCGNRSATRPTRFGTTVDGLLSNLTIATPKIKDLFVAYSRNIAGSNRSVYAIAQCVPTLAQNGCKDCLTVAHSNIMSCLPFVDGRALDTGCFMRYSNKPFYRKNETSIIEPFLRDPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G104080`
TK1151 ID	TkA06G104080
OH-1004 ID	LXL04_013992
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.400
Protein coverage (%)	TK1151 99.381 / OH-1004 99.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G104080

Location Chr06:27599440-27603348 (+)

Description Similar to CRK3: Cysteine-rich receptor-like protein kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70520`	Cysteine-rich receptor-like protein kinase 2.	No verified direct reference in this release
`At5g40380`	Cysteine-rich receptor-like protein kinase 42.	No verified direct reference in this release
`At1g70530`	Cysteine-rich receptor-like protein kinase 3.	No verified direct reference in this release
`At1g19090`	Cysteine-rich receptor-like protein kinase 1.	No verified direct reference in this release
`At4g05200`	Cysteine-rich receptor-like protein kinase 25.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013992 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010193 response to ozone Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0052545 callose localization Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G19090

ath:AT1G70520

ath:AT1G70530

ath:AT4G05200

ath:AT5G40380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.894

Rank 1 · TkA06G104080 · TK1151

Cytoplasm0.075

Rank 2 · TkA06G104080 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA06G104080 · TK1151

Nucleus0.039

Rank 4 · TkA06G104080 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA06G104080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung49-128 aa

PF01657Stress-antifung145-241 aa

PF04478Mid2262-298 aa

PF00069Pkinase334-598 aa

PF07714PK_Tyr_Ser-Thr335-598 aa

PF03109ABC1341-360 aa

PF01636APH357-405 aa

PF03109ABC1399-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G104080	`PF01657`	Stress-antifung	49	128	7.1e-24	85.1
TkA06G104080	`PF01657`	Stress-antifung	145	241	7.1e-24	85.1
TkA06G104080	`PF04478`	Mid2	262	298	0.003	18.1
TkA06G104080	`PF00069`	Pkinase	334	598	1.4e-45	156.5
TkA06G104080	`PF07714`	PK_Tyr_Ser-Thr	335	598	2.2e-48	165.5
TkA06G104080	`PF03109`	ABC1	341	360	2e-05	24.6
TkA06G104080	`PF01636`	APH	357	405	0.0051	17.3
TkA06G104080	`PF03109`	ABC1	399	481	2e-05	24.6
TkA06G104080	`PF12330`	Haspin_kinase	419	484	0.0038	17.0
TkA06G104080	`PF19974`	TCAD9	437	471	0.072	12.9
TkA06G104080	`PF01636`	APH	440	475	0.0051	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAL3`	Arabidopsis thaliana	sp\|Q9CAL3\|CRK2_ARATH Cysteine-rich receptor-like protein kinase 2	41.200%	Swiss-Prot	Medium
`Q9FNE1`	Arabidopsis thaliana	sp\|Q9FNE1\|CRK42_ARATH Cysteine-rich receptor-like protein kinase 42	37.800%	Swiss-Prot	Medium
`Q9CAL2`	Arabidopsis thaliana	sp\|Q9CAL2\|CRK3_ARATH Cysteine-rich receptor-like protein kinase 3	36.100%	Swiss-Prot	Medium
`Q9LMB9`	Arabidopsis thaliana	sp\|Q9LMB9\|CRK1_ARATH Cysteine-rich receptor-like protein kinase 1	38.000%	Swiss-Prot	Medium
`Q9M0X5`	Arabidopsis thaliana	sp\|Q9M0X5\|CRK25_ARATH Cysteine-rich receptor-like protein kinase 25	32.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card