TkA06G086610 | RubberDandelionOmics

Gene overview

TkA06G086610

Reference: TK1151 Chr: Chr06 Coordinates: 23151816-23152160 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA06G086610|TK1151|cDNA

AAAAAGCGAAGGAATTCACATACGCTTCTGCCCCGTTCTTCTTCTTCCTGTTTCTTCCTCCCCTTTTCTTCCTCCGCTTATGCCCCTTTCTCTCCTAATGAAATCGATAAAGTTGTGAAGCTACAAGAAGAACTCGACATTGATGTGCTTGTTCACGGAGAGCCAGAGGTACTTTTCCGACGTGTTCAAAACGACGTGAAATTGCAGAGAAACGACATGGTTGAGTACTTCGGCGAGCAATTATCTGGTTTGCCTTCACC...

CDS

Download CDS FASTA

345 bp · TkA06G086610|TK1151|CDS

AAAAAGCGAAGGAATTCACATACGCTTCTGCCCCGTTCTTCTTCTTCCTGTTTCTTCCTCCCCTTTTCTTCCTCCGCTTATGCCCCTTTCTCTCCTAATGAAATCGATAAAGTTGTGAAGCTACAAGAAGAACTCGACATTGATGTGCTTGTTCACGGAGAGCCAGAGGTACTTTTCCGACGTGTTCAAAACGACGTGAAATTGCAGAGAAACGACATGGTTGAGTACTTCGGCGAGCAATTATCTGGTTTGCCTTCACC...

Protein

Download Protein FASTA

114 aa · TkA06G086610|TK1151|PROTEIN

KKRRNSHTLLPRSSSSCFFLPFSSSAYAPFSPNEIDKVVKLQEELDIDVLVHGEPEVLFRRVQNDVKLQRNDMVEYFGEQLSGLPSPPTCGCSLTAPDVSNHRSSTAMSVVPNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G086610`
TK1151 ID	TkA06G086610
OH-1004 ID	LXL04_011560
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 73.684 / OH-1004 38.182 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G086610

Location Chr06:23151816-23152160 (-)

Description Similar to MET: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011560 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0009086 methionine biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0032259 methylation Biological Process

GO:0071266 'de novo' L-methionine biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ag:CAA58474

ath:AT5G17920

dosa:Os12g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.426

Rank 1 · TkA06G086610 · TK1151

Cytoplasm0.342

Rank 2 · TkA06G086610 · TK1151

Mitochondrion0.120

Rank 3 · TkA06G086610 · TK1151

Cell membrane0.113

Rank 4 · TkA06G086610 · TK1151

Endoplasmic reticulum0.102

Rank 5 · TkA06G086610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01717Meth_synt_223-84 aa

PF15229POM12178-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G086610	`PF01717`	Meth_synt_2	23	84	9.8e-10	38.9
TkA06G086610	`PF15229`	POM121	78	103	0.17	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2QLY4`	Oryza sativa subsp. japonica	sp\|Q2QLY4\|METE2_ORYSJ 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	62.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card