TkA06G072030 | RubberDandelionOmics

Gene overview

TkA06G072030

Reference: TK1151 Chr: Chr06 Coordinates: 19294470-19294971 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA06G072030|TK1151|cDNA

ATGGGATCAGGAATCTTGGTTAGAGGAATGGTACAAGCATATCGCCAGGCCCTTCAAAATGCCTCGAAATCAGGTGTGGCTCAAGAAACATTAAAGAATGCTGTGCGTAGTGGAAGCAAAGCCATGACTGAACAAGAGGCCAGACAAATCCTTGGTGTGACTGACCACTCATCATGGGAGGAAGTTGCACAGAAATATGATAATCTATTTGAGCGAAATGCCAAGAATGGGAGTTTTTATCTTCAGTCGAAGGTTCACAG...

CDS

Download CDS FASTA

324 bp · TkA06G072030|TK1151|CDS

ATGGGATCAGGAATCTTGGTTAGAGGAATGGTACAAGCATATCGCCAGGCCCTTCAAAATGCCTCGAAATCAGGTGTGGCTCAAGAAACATTAAAGAATGCTGTGCGTAGTGGAAGCAAAGCCATGACTGAACAAGAGGCCAGACAAATCCTTGGTGTGACTGACCACTCATCATGGGAGGAAGTTGCACAGAAATATGATAATCTATTTGAGCGAAATGCCAAGAATGGGAGTTTTTATCTTCAGTCGAAGGTTCACAG...

Protein

Download Protein FASTA

107 aa · TkA06G072030|TK1151|PROTEIN

MGSGILVRGMVQAYRQALQNASKSGVAQETLKNAVRSGSKAMTEQEARQILGVTDHSSWEEVAQKYDNLFERNAKNGSFYLQSKVHRAKECLETVYQPKDQPGGNVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G072030`
TK1151 ID	TkA06G072030
OH-1004 ID	LXL04_025247
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 90.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G072030

Location Chr06:19294470-19294971 (+)

Description Similar to PAM16L2: Mitochondrial import inner membrane translocase subunit PAM16 like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59280`	Regulates ATP-dependent protein translocation into the mitochondrial matrix (By similarity).	An Arabidopsis mutant resistant to thaxtomin A, a cellulose synthesis inhibitor from Streptomyces species.2003 · DOI: 10.1105/tpc.013342 Enhanced resistance to the cellulose biosynthetic inhibitors, thaxtomin A and isoxaben in Arabidopsis thaliana mutants, also provides specific co-resistance to the auxin transport inhibitor, 1-NPA.2013 · DOI: 10.1186/1471-2229-13-76 Mitochondrial AtPAM16 is required for plant survival and the negative regulation of plant immunity.2013 · DOI: 10.1038/ncomms3558
`At5g61880`	Regulates ATP-dependent protein translocation into the mitochondrial matrix.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902289 negative regulation of defense response to oomycetes Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:2000378 negative regulation of reactive oxygen species metabolic process Biological Process

GO:0001405 PAM complex, Tim23 associated import motor Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G59280

ath:AT5G61880

dme:Dmel_CG5268

ncr:NCU05515

spo:2541152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.952

Rank 1 · TkA06G072030 · TK1151

Nucleus0.075

Rank 2 · TkA06G072030 · TK1151

Cytoplasm0.068

Rank 3 · TkA06G072030 · TK1151

Cell membrane0.031

Rank 4 · TkA06G072030 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA06G072030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03656Pam162-96 aa

PF10023Aminopep8-100 aa

PF19936DUF639913-74 aa

PF26361MIB_arm14-76 aa

PF30912TIM141_C40-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G072030	`PF03656`	Pam16	2	96	2.3e-17	63.9
TkA06G072030	`PF10023`	Aminopep	8	100	0.0055	16.8
TkA06G072030	`PF19936`	DUF6399	13	74	0.089	13.5
TkA06G072030	`PF26361`	MIB_arm	14	76	0.022	15.9
TkA06G072030	`PF30912`	TIM141_C	40	93	2.7e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VV9`	Arabidopsis thaliana	sp\|Q93VV9\|TM16B_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 2	75.300%	Swiss-Prot	High
`Q93W66`	Arabidopsis thaliana	sp\|Q93W66\|TM16A_ARATH Mitochondrial import inner membrane translocase subunit PAM16 like 1	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card