TkA06G036650 | RubberDandelionOmics

Gene overview

TkA06G036650

Reference: TK1151 Chr: Chr06 Coordinates: 9830545-9839022 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

665 bp · TkA06G036650|TK1151|cDNA

CCACACCATGTTGACCAGCCAGTAGAAAGTAGATGGGTTTATGTGCATCCTGATCCATTCTTTATTCCTTTTCACCTTTACTTTCAACAACCCAAGCTCCCCCCTCCTTCTCATTCTCCAACCGATCGAAGGACTAGCTTTCTTATGGATTCACCCTCCGAATCCAATGGCGACGAACCCTCACAATCCAAACAAACACCTCGATCAGAAACCAATGGTAATCGTCACAATCATCGAACATCTTCAGGCGTCGTATCCTC...

CDS

Download CDS FASTA

630 bp · TkA06G036650|TK1151|CDS

ATGCTCTGCTTCCTGTGGATTAAAACTCTTGAAGGTGAAATGGGGGTTACTACCAAACAAATGTCTCTGATTGTTGGATTCCTTGGTGTTTTGTCATTCGTATTCGGCGTTATTGCTGAAAACAAGAAGCCGGCATCTGGAACTCCGATTACTGGAAAAGACGTGGTCATCTGTAAGTATCCAGCGGACCCCACAGTCGCATTGGGGTATTTATCTTTTGGATTTCTTGTTGCTTCAACTTTGGCCGGAGGTTTATCTCT...

Protein

Download Protein FASTA

209 aa · TkA06G036650|TK1151|PROTEIN

MLCFLWIKTLEGEMGVTTKQMSLIVGFLGVLSFVFGVIAENKKPASGTPITGKDVVICKYPADPTVALGYLSFGFLVASTLAGGLSLFYPYKGKSIPWPTLFQSTSFFVFFLISLGSTGLAATMLLWPTITEHKHLVSNVHFNLETTCPTAKTGLLGGGAFLALDSALFWLVSLMLADNAREDYFDDVKGSGGDGDGDYDVDGVIKGSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G036650`
TK1151 ID	TkA06G036650
OH-1004 ID	LXL04_025936
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.400
Protein coverage (%)	TK1151 93.780 / OH-1004 99.487 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G036650

Location Chr06:9830545-9839022 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63420`	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems.	Heterotrimeric G protein gamma subunits provide functional selectivity in Gbetagamma dimer signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.050096 Arabidopsis N-MYC DOWNREGULATED-LIKE1, a positive regulator of auxin transport in a G protein-mediated pathway.2009 · DOI: 10.1105/tpc.109.065557 Arabidopsis heterotrimeric G-protein regulates cell wall defense and resistance to necrotrophic fungi.2012 · DOI: 10.1093/mp/ssr082

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X0N9`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release
`Os02g0137800`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025936 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.559

Rank 1 · TkA06G036650 · TK1151

Lysosome / Vacuole0.182

Rank 2 · TkA06G036650 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA06G036650 · TK1151

Cytoplasm0.120

Rank 4 · TkA06G036650 · TK1151

Golgi apparatus0.070

Rank 5 · TkA06G036650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06749DUF121820-43 aa

PF06749DUF121875-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G036650	`PF06749`	DUF1218	20	43	3e-17	63.6
TkA06G036650	`PF06749`	DUF1218	75	168	3e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FDX9`	Arabidopsis thaliana	sp\|Q9FDX9\|GG1_ARATH Guanine nucleotide-binding protein subunit gamma 1	44.300%	Swiss-Prot	Low
`A2X0N9`	Oryza sativa subsp. indica	sp\|A2X0N9\|GG2_ORYSI Guanine nucleotide-binding protein subunit gamma 2	47.000%	Swiss-Prot	Low
`Q6YXX9`	Oryza sativa subsp. japonica	sp\|Q6YXX9\|GG2_ORYSJ Guanine nucleotide-binding protein subunit gamma 2	47.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card