TkA06G027490 | RubberDandelionOmics

Gene overview

TkA06G027490

Reference: TK1151 Chr: Chr06 Coordinates: 7431596-7433020 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1214 bp · TkA06G027490|TK1151|cDNA

AAACAATTAGTTGCTCACAAATTCTAACTATATCCATATAATATCGATAAAGGATATTCGGCAAAACAATTTAGATCATATATTAAAATGATCCAAAATGATATTATTGTTTAACAAAAAACACGTCAACGGTCGTGTCCACAATTCATTCGATCCATTAAATGTGGAGAGGTTAACTACCAATTCCAAATTCCAAAATCCAGACTCAGTGATTGATTCTTCGAATGCTTATTGGATCAATTCTTCTTCTTTCTTTCTTT...

CDS

Download CDS FASTA

495 bp · TkA06G027490|TK1151|CDS

ATGAGCAGTGACAAGGAAGCCGTGAAACTCGACGACGAACAACTGGCAGAGCTCCGGGAGATATTCCGATCGTTCGACAGAAACAACGACGGCAGCCTCACACAACTCGAATTAGGTTCGTTGTTACGATCCTTGGGTCTCACACCTAGCCCGGACCAGCTCGATGCATTGATACAGAAAGCCGATACCAACAGCAACGGTTTGGTGGAGTTCTCGGAGTTTGTGGCGCTGGTGGCGCCGGAGCTTCTTCCGGCGAAGTC...

Protein

Download Protein FASTA

164 aa · TkA06G027490|TK1151|PROTEIN

MSSDKEAVKLDDEQLAELREIFRSFDRNNDGSLTQLELGSLLRSLGLTPSPDQLDALIQKADTNSNGLVEFSEFVALVAPELLPAKSPYTDDQLKQLFKMFDRDGNGYITAAELAHSMAKLGHALTAEELTGMIKEADTDGDGRINFQEFSRAITSAAFDNSFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G027490`
TK1151 ID	TkA06G027490
OH-1004 ID	LXL04_021422
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.100
Protein coverage (%)	TK1151 84.756 / OH-1004 84.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G027490

Location Chr06:7431596-7433020 (+)

Description Similar to CML16: Probable calcium-binding protein CML16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32250`	Potential calcium sensor.	No verified direct reference in this release
`At3g03000`	Potential calcium sensor that modulates ion selectivity of NHX1.	Vacuolar Na+/H+ antiporter cation selectivity is regulated by calmodulin from within the vacuole in a Ca2+- and pH-dependent manner.2005 · DOI: 10.1073/pnas.0504437102

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0505600`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021422 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G18530

ath:AT1G32250

ath:AT3G25600

dosa:Os01g0604500

dosa:Os05g0577500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA06G027490 · TK1151

Nucleus0.237

Rank 2 · TkA06G027490 · TK1151

Cell membrane0.147

Rank 3 · TkA06G027490 · TK1151

Lysosome / Vacuole0.117

Rank 4 · TkA06G027490 · TK1151

Endoplasmic reticulum0.096

Rank 5 · TkA06G027490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23564EF-hand_FSTL17-86 aa

PF03460NIR_SIR_ferr10-26 aa

PF00046Homeodomain10-24 aa

PF21008AIF-112-77 aa

PF12763EH13-76 aa

PF30624EF_SSP12013-36 aa

PF20742DUF5580_M14-78 aa

PF22592FCaBP_EF-hand14-40 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G027490	`PF23564`	EF-hand_FSTL1	7	86	5.4e-13	50.1
TkA06G027490	`PF03460`	NIR_SIR_ferr	10	26	0.018	15.5
TkA06G027490	`PF00046`	Homeodomain	10	24	0.12	12.9
TkA06G027490	`PF21008`	AIF-1	12	77	1.1e-09	39.4
TkA06G027490	`PF12763`	EH	13	76	4.1e-09	37.0
TkA06G027490	`PF30624`	EF_SSP120	13	36	8.5e-05	23.8
TkA06G027490	`PF20742`	DUF5580_M	14	78	9.3e-06	26.3
TkA06G027490	`PF22592`	FCaBP_EF-hand	14	40	1.4e-05	26.0
TkA06G027490	`PF25825`	SAPC2_N	15	82	5.2e-05	23.8
TkA06G027490	`PF25578`	EF-hand_STIM1	15	39	0.0078	17.0
TkA06G027490	`PF13499`	EF-hand_7	17	78	5.8e-37	126.6
TkA06G027490	`PF00036`	EF-hand_1	17	45	1.8e-33	112.3
TkA06G027490	`PF13405`	EF-hand_6	17	46	5.4e-28	94.7
TkA06G027490	`PF13833`	EF-hand_8	17	37	6.3e-25	87.4
TkA06G027490	`PF13202`	EF-hand_5	18	41	1.1e-22	79.1
TkA06G027490	`PF24548`	EF_EFCAB10_C	18	51	1.3e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQN4`	Arabidopsis thaliana	sp\|Q9LQN4\|CML17_ARATH Probable calcium-binding protein CML17	77.200%	Swiss-Prot	High
`Q9M8U1`	Arabidopsis thaliana	sp\|Q9M8U1\|CML18_ARATH Probable calcium-binding protein CML18	80.800%	Swiss-Prot	High
`Q9AWK2`	Oryza sativa subsp. japonica	sp\|Q9AWK2\|CML11_ORYSJ Probable calcium-binding protein CML11	82.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card