RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G026740
Reference: TK1151 Chr: Chr06 Coordinates: 7209356-7219183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4221 bp · TkA06G026740|TK1151|cDNA

ATGAGTCAACACACTCTGGCTGGTTTACTTTTGCTTTGCATTAAATAGCCTTGAACCACCGAACCAATTTTCTCATCCTTATGTAGCCCCACCGCCACCACCACCATTCGCTTCCTTAACCCTCTTCTCCACTTGTTTTGATTACCAAAATGAGCAACCCCACATCACTCTCCGTCGACGGCGGCGGCGTTGACACGACAGATGGCAAGGAACATCAAACCATAAAACCCAAAACCGTTCCAATGCTAAAACTGTTTGCA...

CDS

Download CDS FASTA

3765 bp · TkA06G026740|TK1151|CDS

ATGAGCAACCCCACATCACTCTCCGTCGACGGCGGCGGCGTTGACACGACAGATGGCAAGGAACATCAAACCATAAAACCCAAAACCGTTCCAATGCTAAAACTGTTTGCATTTGCCGATTCCTATGATTACTTTCTTATGTTTTTTGGGTCCCTCGGAGCATGCATTCACGGGGCATCGGTGCCGGTTTTCTTCATCTTTTTCGGCAAGCTGATCAACATCATCGGACTTGCTTATCTTTTTCCCAAAGAAGCTTCTCA...

Protein

Download Protein FASTA

1254 aa · TkA06G026740|TK1151|PROTEIN

MSNPTSLSVDGGGVDTTDGKEHQTIKPKTVPMLKLFAFADSYDYFLMFFGSLGACIHGASVPVFFIFFGKLINIIGLAYLFPKEASHKVAKYSLDFVYLSVVILFSSWTEVACWMHSGERQAAKMRMAYLKSMLSQDISLFDTEASTGEVISAITSDIIVVQDAISEKVGNFMHYISRFLSGFIIGFVRVWQISLVTLSIVPAIAIAGGVYAYVATGLIARVRKSYVKAGEIAEEVIGNVRTVQAFSGEEKAVNSYIDAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G026740
TK1151 IDTkA06G026740
OH-1004 IDLXL04_026130
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G026740
LocationChr06:7209356-7219183 (+)
DescriptionSimilar to ABCB2: ABC transporter B family member 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g25960 ABC transporter B family member 2. No verified direct reference in this release
At1g10680 ABC transporter B family member 10. No verified direct reference in this release
At3g28860 May participate in brassinosteroid export and related signaling.
TWISTED DWARF1, a unique plasma membrane-anchored immunophilin-like protein, interacts with Arabidopsis multidrug resistance-like transporters AtPGP1 and AtPGP19.2003 · DOI: 10.1091/mbc.e02-10-0698
Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023
An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223
Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185
Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591
ABCB19 transporter: fostering brassinosteroid transport through membrane flexibility.2024 · DOI: 10.1016/j.tplants.2024.06.005
Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
Quantitative analysis of the root posture of Arabidopsis thaliana mutants with wavy roots.2024 · DOI: 10.1017/qpb.2024.12
At1g27940 ABC transporter B family member 13. No verified direct reference in this release
At1g28010 ABC transporter B family member 14. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026130 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008361 regulation of cell size Biological Process
GO:0009555 pollen development Biological Process
GO:0009637 response to blue light Biological Process
GO:0009639 response to red or far red light Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0009958 positive gravitropism Biological Process
GO:0010218 response to far red light Biological Process
KEGG gene cross-reference
ath:AT1G10680
ath:AT1G27940
ath:AT1G28010
ath:AT3G28860
ath:AT4G25960
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.587
Rank 1 · TkA06G026740 · TK1151
Lysosome / Vacuole0.187
Rank 2 · TkA06G026740 · TK1151
Endoplasmic reticulum0.108
Rank 3 · TkA06G026740 · TK1151
Cytoplasm0.107
Rank 4 · TkA06G026740 · TK1151
Golgi apparatus0.050
Rank 5 · TkA06G026740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane48-319 aa
PF13479AAA_24133-165 aa
PF12092DUF3568195-263 aa
PF20820Fib-H_N222-246 aa
PF20820Fib-H_N346-369 aa
PF03193RsgA_GTPase387-419 aa
PF19557BrxC-PglY_N387-454 aa
PF13476AAA_23387-419 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G026740PF00664ABC_membrane483191.9e-91307.3
TkA06G026740PF13479AAA_241331650.3711.2
TkA06G026740PF12092DUF35681952630.1612.8
TkA06G026740PF20820Fib-H_N2222460.6810.9
TkA06G026740PF20820Fib-H_N3463690.6810.9
TkA06G026740PF03193RsgA_GTPase3874192.4e-0524.9
TkA06G026740PF19557BrxC-PglY_N3874540.0006919.7
TkA06G026740PF13476AAA_233874190.002419.3
TkA06G026740PF13555AAA_293894162.9e-0730.9
TkA06G026740PF00005ABC_tran3905381.5e-70236.8
TkA06G026740PF01580FtsK_SpoIIIE3914160.1112.7
TkA06G026740PF05783DLIC3944300.1112.1
TkA06G026740PF09818ABC_ATPase3954212.6e-0627.4
TkA06G026740PF13481AAA_253964160.01515.6
TkA06G026740PF13191AAA_163974291.2e-0526.6
TkA06G026740PF12775AAA_73974170.0613.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LPK2Arabidopsis thalianasp|Q8LPK2|AB2B_ARATH ABC transporter B family member 278.800%Swiss-ProtHigh
Q9SGY1Arabidopsis thalianasp|Q9SGY1|AB10B_ARATH ABC transporter B family member 1077.900%Swiss-ProtHigh
Q9LJX0Arabidopsis thalianasp|Q9LJX0|AB19B_ARATH ABC transporter B family member 1952.000%Swiss-ProtHigh
Q9C7F8Arabidopsis thalianasp|Q9C7F8|AB13B_ARATH ABC transporter B family member 1350.600%Swiss-ProtHigh
Q9C7F2Arabidopsis thalianasp|Q9C7F2|AB14B_ARATH ABC transporter B family member 1450.700%Swiss-ProtHigh

JBrowse

View in Genome Browser