TkA06G023310 | RubberDandelionOmics

Gene overview

TkA06G023310

Reference: TK1151 Chr: Chr06 Coordinates: 6383573-6394166 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1752 bp · TkA06G023310|TK1151|cDNA

TCTAGATCCTTTAATTCCATTACTTTCAAGTTTCAACCAAAAGCCATATCATCCGTCATCCACACAAAACACCTATAAATACAACAAAAGCTTGAGGGAGTCATATGCTGCTTAAAATCCATCTCCTCAGTCGTCGTCAACAAGTATTTGATGGAGAAATCTGACATGACGATCGACTGTTTAAACAAGAAACCTCGTACTCTCATAGAGAAGACGAAAACTTATCTGGGTTCTTTATGTCGGGAAATTTGGAAAATCAG...

CDS

Download CDS FASTA

1341 bp · TkA06G023310|TK1151|CDS

ATGGAGCCATTGTTCAAAGGGGTCGGACAAAGTGCGATTGGGGCCGTCATGACTGTCGTCGTTGTGCTGGAATTCACCGCCGGGGCGACCTTATGCAAAGGATTAAATCGGGGATTCGGGACGTTATTAGCAGCATCGTTAGCCTTCTTATTCGAGTTTATAGCTCGAGAATACGGGAAGGTTTTTCGAGCTGTTTTCATTGGAGCTTCCATTTTTTTAATTGGCACATCGACAACATTTTTGAGATTTTTTCCCAAAAT...

Protein

Download Protein FASTA

446 aa · TkA06G023310|TK1151|PROTEIN

MEPLFKGVGQSAIGAVMTVVVVLEFTAGATLCKGLNRGFGTLLAASLAFLFEFIAREYGKVFRAVFIGASIFLIGTSTTFLRFFPKIKKNYDYGVLVFLLTFNLITVSSYRVDDILKLAKGRTYMIGIGSGICVVMSLFIFPNWSGEDLHNHTVCKIEGLAKSIQACVTKYFGDEEPNSDIDETMEDPIYENYKAVLDSKSLDETLARHASWEPRNTWRCHNKFPCQQYVKLGGVLRHFGYGVVALHGTLQTEIRTPRSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G023310`
TK1151 ID	TkA06G023310
OH-1004 ID	LXL04_026168
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 99.552 / OH-1004 87.574 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G023310

Location Chr06:6383573-6394166 (-)

Description Similar to ALMT12: Aluminum-activated malate transporter 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46610`	Malate transporter.	No verified direct reference in this release
`At4g17970`	Malate-sensitive anion transporter permeable to chloride, nitrate, sulfate and malate.	Closing plant stomata requires a homolog of an aluminum-activated malate transporter.2010 · DOI: 10.1093/pcp/pcq016 AtALMT12 represents an R-type anion channel required for stomatal movement in Arabidopsis guard cells.2010 · DOI: 10.1111/j.1365-313x.2010.04302.x
`At5g46600`	Malate transporter.	No verified direct reference in this release
`At4g00910`	Malate transporter.	No verified direct reference in this release
`At1g08440`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026168 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010118 stomatal movement Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0008509 monoatomic anion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G08440

ath:AT4G17970

ath:AT5G46600

ath:AT5G46610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.848

Rank 1 · TkA06G023310 · TK1151

Endoplasmic reticulum0.109

Rank 2 · TkA06G023310 · TK1151

Cytoplasm0.063

Rank 3 · TkA06G023310 · TK1151

Nucleus0.039

Rank 4 · TkA06G023310 · TK1151

Lysosome / Vacuole0.031

Rank 5 · TkA06G023310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744ALMT1-411 aa

PF13515FUSC_212-135 aa

PF04632FUSC15-49 aa

PF11833CPP1-like16-77 aa

PF08122NDUF_B1225-48 aa

PF04632FUSC122-148 aa

PF10337ArAE_2_N126-181 aa

PF08122NDUF_B12212-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G023310	`PF11744`	ALMT	1	411	8.3e-134	447.7
TkA06G023310	`PF13515`	FUSC_2	12	135	7.3e-08	33.3
TkA06G023310	`PF04632`	FUSC	15	49	0.02	14.2
TkA06G023310	`PF11833`	CPP1-like	16	77	0.092	13.1
TkA06G023310	`PF08122`	NDUF_B12	25	48	0.24	12.0
TkA06G023310	`PF04632`	FUSC	122	148	0.02	14.2
TkA06G023310	`PF10337`	ArAE_2_N	126	181	0.0089	15.8
TkA06G023310	`PF08122`	NDUF_B12	212	251	0.24	12.0
TkA06G023310	`PF04632`	FUSC	272	311	0.02	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS22`	Arabidopsis thaliana	sp\|Q9LS22\|ALMTE_ARATH Aluminum-activated malate transporter 14	56.500%	Swiss-Prot	High
`O49696`	Arabidopsis thaliana	sp\|O49696\|ALMTC_ARATH Aluminum-activated malate transporter 12	54.800%	Swiss-Prot	High
`Q9LS23`	Arabidopsis thaliana	sp\|Q9LS23\|ALMTD_ARATH Aluminum-activated malate transporter 13	54.000%	Swiss-Prot	High
`O23086`	Arabidopsis thaliana	sp\|O23086\|ALMTA_ARATH Aluminum-activated malate transporter 10	32.600%	Swiss-Prot	Medium
`Q9SJE8`	Arabidopsis thaliana	sp\|Q9SJE8\|ALMT2_ARATH Aluminum-activated malate transporter 2	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card