TkA06G018910 | RubberDandelionOmics

Gene overview

TkA06G018910

Reference: TK1151 Chr: Chr06 Coordinates: 5165789-5168489 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2023 bp · TkA06G018910|TK1151|cDNA

GTCTCTCTATATAAATCCATGGATAACCCCTGCTGCCCATTACACATACAGAATCCCCTCCCTTATGATCCTCATAATCACGAGCTCTCAAATCAAAAGCTTAGGGTTCTTCCGAATCTAATTGATTGCTTATAGGTAAACCCTTCGATTCTCTATACATCGATTTAAGCTCTTCTGTTTAACGACGTTTGATTATACGTATAATTCCGTTTGTGATTAGAATATTCTTTCTTTTCTACTCGAATAGTAATATTGGGAGC...

CDS

Download CDS FASTA

1143 bp · TkA06G018910|TK1151|CDS

ATGGATTCTCAGAACCCTGAACATGAACACAGACACACTGTTGACATATCAGCAGCCGTACCACTACCACCTGAAGAAAACCGCCAAACTACAAACAAAGTCTGTGGTGGAGCACCATGCGGATTCTCAGATTCCAACACAACTTCCATGGAAGCAAAAGAACGTTCAGCATCCATGTGGAAGCTCTGGTGTGGTGTCATCTTATGCGTCATCTTCATGAGTGTAGAAGTAGTAGGTGGAATCAAAGCCAACAGTCTAGC...

Protein

Download Protein FASTA

380 aa · TkA06G018910|TK1151|PROTEIN

MDSQNPEHEHRHTVDISAAVPLPPEENRQTTNKVCGGAPCGFSDSNTTSMEAKERSASMWKLWCGVILCVIFMSVEVVGGIKANSLAILTDAAHLLSDVAAFAISIFSVWASGWEATPRQSYGFFRIEILGTLVSIQIIWLLTGILVYEAIERLLHGTVEVQGSLMFGISAFGLVVNIIMIFVLGHEHGHGHSHGHDHGVSVTTHDHHHGHDDDHDQNQPLLKTYSSQETKEKKRGNINVQGAYLHVLGDIIQSIGVMIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G018910`
TK1151 ID	TkA06G018910
OH-1004 ID	LXL04_026236
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G018910

Location Chr06:5165789-5168489 (+)

Description Similar to MTP1: Metal tolerance protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46800`	Mediates zinc accumulation in roots and confers resistance to zinc.	Zinc transporter of Arabidopsis thaliana AtMTP1 is localized to vacuolar membranes and implicated in zinc homeostasis.2004 · DOI: 10.1093/pcp/pci015 A mutant strain Arabidopsis thaliana that lacks vacuolar membrane zinc transporter MTP1 revealed the latent tolerance to excessive zinc.2009 · DOI: 10.1093/pcp/pcp067 A mutation in the Arabidopsis thaliana cell wall biosynthesis gene pectin methylesterase 3 as well as its aberrant expression cause hypersensitivity specifically to Zn.2013 · DOI: 10.1111/tpj.12279
`At3g58810`	Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis.	The Arabidopsis metal tolerance protein AtMTP3 maintains metal homeostasis by mediating Zn exclusion from the shoot under Fe deficiency and Zn oversupply.2006 · DOI: 10.1111/j.1365-313x.2006.02746.x
`At3g61940`	Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis.	No verified direct reference in this release
`At2g29410`	Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0128400`	Involved in sequestration of excess zinc in the cytoplasm into vacuoles to maintain zinc homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026236 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006829 zinc ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0010312 detoxification of zinc ion Biological Process

GO:0030001 metal ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G29410

ath:AT2G46800

ath:AT3G58810

ath:AT3G61940

dosa:Os05g0128400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.409

Rank 1 · TkA06G018910 · TK1151

Cytoplasm0.251

Rank 2 · TkA06G018910 · TK1151

Golgi apparatus0.241

Rank 3 · TkA06G018910 · TK1151

Cell membrane0.183

Rank 4 · TkA06G018910 · TK1151

Endoplasmic reticulum0.140

Rank 5 · TkA06G018910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16479DUF505641-99 aa

PF01545Cation_efflux63-301 aa

PF16479DUF505699-144 aa

PF16479DUF5056132-179 aa

PF02535Zip139-255 aa

PF07685GATase_3191-248 aa

PF07685GATase_3277-305 aa

PF16479DUF5056278-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G018910	`PF16479`	DUF5056	41	99	3.9	8.8
TkA06G018910	`PF01545`	Cation_efflux	63	301	5.4e-45	154.3
TkA06G018910	`PF16479`	DUF5056	99	144	3.9	8.8
TkA06G018910	`PF16479`	DUF5056	132	179	3.9	8.8
TkA06G018910	`PF02535`	Zip	139	255	0.00024	21.2
TkA06G018910	`PF07685`	GATase_3	191	248	0.33	11.2
TkA06G018910	`PF07685`	GATase_3	277	305	0.33	11.2
TkA06G018910	`PF16479`	DUF5056	278	303	3.9	8.8
TkA06G018910	`PF16916`	ZT_dimer	305	379	2.1e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT63`	Arabidopsis thaliana	sp\|Q9ZT63\|MTP1_ARATH Metal tolerance protein 1	69.900%	Swiss-Prot	High
`Q9LXS1`	Arabidopsis thaliana	sp\|Q9LXS1\|MTPA2_ARATH Metal tolerance protein A2	70.100%	Swiss-Prot	High
`Q9M271`	Arabidopsis thaliana	sp\|Q9M271\|MTPA1_ARATH Metal tolerance protein A1	68.200%	Swiss-Prot	High
`Q6DBM8`	Arabidopsis thaliana	sp\|Q6DBM8\|MTPB_ARATH Metal tolerance protein B	49.900%	Swiss-Prot	Medium
`Q688R1`	Oryza sativa subsp. japonica	sp\|Q688R1\|MTP1_ORYSJ Metal tolerance protein 1	69.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card