TkA06G013770 | RubberDandelionOmics

Gene overview

TkA06G013770

Reference: TK1151 Chr: Chr06 Coordinates: 3639735-3644590 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2516 bp · TkA06G013770|TK1151|cDNA

CATTTCTGAGCTTTTGGCACCTTCCCTTTCCTCTCCTCCAATCCTCCATATATACCATCCCTTTGCATCACTTCTTTCTCCACCCCCTCTCTCTCTCTCTAGAACTGGTTTCTCAGGACTTCAATCCGATAAACCAAACCAACATTGCCATATTAAAAGATCCAGTTTATTGTTCTTTCTTCTTTAACAAAAAAGTTGACTTATTTGATTTGTAATGGAAGTCTTTATGAGACTGTATTCAATGGCAACTACTCTGTTTC...

CDS

Download CDS FASTA

1857 bp · TkA06G013770|TK1151|CDS

ATGGAAGTCTTTATGAGACTGTATTCAATGGCAACTACTCTGTTTCTGCTTATCGGGATTGTACCTTTGGCTTTAGCAGCTGGACATAACTACGGGCAAGCTTTAAGCAAAGGCATTCTCTTCTTCGAAGCTCAAAGATCCGGTTACCTTCCCGGTAGCCAAAGAGTCAAATGGCGCGGCAATTCCGGTCTCATGGACGGGAAAGTCAATGGGGTGGATCTTGTGGGAGGGTACTATGACGCCGGCGACAATGTGAAGTT...

Protein

Download Protein FASTA

618 aa · TkA06G013770|TK1151|PROTEIN

MEVFMRLYSMATTLFLLIGIVPLALAAGHNYGQALSKGILFFEAQRSGYLPGSQRVKWRGNSGLMDGKVNGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAMSGELAHAMDAVKWGTDYLMKAHPQPHVLYGEVGDGNTDHYCWQRPEDMTTSRNAYRIDQNNPGSDLAGETAAAMAAASIVFRRYNPAYSKQLLTHAYQLFDFADKYRGKYDSSITVAQKYYRSVSGYADELLWGAAWMYKATNNKYYLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G013770`
TK1151 ID	TkA06G013770
OH-1004 ID	LXL04_026348
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G013770

Location Chr06:3639735-3644590 (-)

Description Similar to At1g64390: Endoglucanase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g64390`	Endoglucanase 6.	No verified direct reference in this release
`At4g11050`	Endoglucanase 19.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0220100`	Hydrolyzes 1,4-beta-glycosyl linkages of 1,4-beta-glucans and 1,3-1,4-beta-glucans.	No verified direct reference in this release
`Os05g0212300`	Endoglucanase 15.	No verified direct reference in this release
`Os01g0219600`	Endoglucanase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026348 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G64390

ath:AT4G11050

dosa:Os01g0219600

dosa:Os01g0220100

dosa:Os05g0212300

osa:4324641

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.592

Rank 1 · TkA06G013770 · TK1151

Lysosome / Vacuole0.161

Rank 2 · TkA06G013770 · TK1151

Cell membrane0.127

Rank 3 · TkA06G013770 · TK1151

Cytoplasm0.105

Rank 4 · TkA06G013770 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA06G013770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759Glyco_hydro_931-490 aa

PF09478CBM49529-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G013770	`PF00759`	Glyco_hydro_9	31	490	1.4e-167	559.1
TkA06G013770	`PF09478`	CBM49	529	603	5.9e-21	75.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42059`	Arabidopsis thaliana	sp\|Q42059\|GUN6_ARATH Endoglucanase 6	73.500%	Swiss-Prot	High
`Q8L7I0`	Arabidopsis thaliana	sp\|Q8L7I0\|GUN19_ARATH Endoglucanase 19	71.200%	Swiss-Prot	High
`Q5NAT0`	Oryza sativa subsp. japonica	sp\|Q5NAT0\|GUN2_ORYSJ Endoglucanase 2	63.400%	Swiss-Prot	High
`Q6L4I2`	Oryza sativa subsp. japonica	sp\|Q6L4I2\|GUN15_ORYSJ Endoglucanase 15	61.800%	Swiss-Prot	High
`Q5NAT8`	Oryza sativa subsp. japonica	sp\|Q5NAT8\|GUN1_ORYSJ Endoglucanase 1	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card