RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G457490
Reference: TK1151 Chr: Chr05 Coordinates: 114627587-114631489 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2039 bp · TkA05G457490|TK1151|cDNA

GGTAGCTCCGTTCCAACTTTGTATAGGGGCTATCATTGTCAACTTTGTAAAGTTTAGGGGGTAAATATGAACTTTTGTAAAAATTATAACAAGAAAACAAAATTTGTTTGATGCCTGCTGGGGGAGAGAGAGAAGTGTAGAGAGAGAAATAGAGGTAGAGCGAGATAGAGAGAGATGGGTAAAGTAGGCGGAGCAACGCCGGCGAAGAAGAAAAAAGGCCGTCCATCGCTCGTAGATCTAAAAAAGCGAGCATTAGAAGA...

CDS

Download CDS FASTA

1248 bp · TkA05G457490|TK1151|CDS

ATGGACACACTGCATGGATCACCATTGGAGGCTGGACCCACTACACCTTTGCCAGACAAAAAGTTGTTGGTGTTCATTCTTGACAGACTTCAAAAGAAGGACACTCATGCAGTATTCTCCGAGCCAGTTGATCCTGATGAGCTCCCTGATTACCATGAAGTTATAGAACAGCCTATGGATTTTGGCACTGTTAGGAGCAAACTCAACAAGGGTCTTTACTCGAATCTTGAAGAATTGGAGGCAGATGTTTATTTAATTTG...

Protein

Download Protein FASTA

415 aa · TkA05G457490|TK1151|PROTEIN

MDTLHGSPLEAGPTTPLPDKKLLVFILDRLQKKDTHAVFSEPVDPDELPDYHEVIEQPMDFGTVRSKLNKGLYSNLEELEADVYLICSNAMQYNTSDTVFYRQVILFLLLARSIQELAKRDFENLRQEGEGGELQPKVVRRGRPPSKHLKKPPVPVHVPESTSGATLATPVDNESTPYNLRRGPTLYPSYRTRNGDNQSEISSDWNEEFPANIRRADMKYGNKHFIIDESRRDTYKEFHPSNYAQQHSLLSNFGGERKQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G457490
TK1151 IDTkA05G457490
OH-1004 IDLXL04_022238
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)95.500
Protein coverage (%)TK1151 100.000 / OH-1004 70.420
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G457490
LocationChr05:114627587-114631489 (+)
DescriptionSimilar to Brpf3: Bromodomain and PHD finger-containing protein 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006271 DNA strand elongation involved in DNA replication Biological Process
GO:0006338 chromatin remodeling Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0035726 common myeloid progenitor cell proliferation Biological Process
GO:0035902 response to immobilization stress Biological Process
GO:0045740 positive regulation of DNA replication Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048145 regulation of fibroblast proliferation Biological Process
GO:0050793 regulation of developmental process Biological Process
GO:0051602 response to electrical stimulus Biological Process
KEGG gene cross-reference
dme:Dmel_CG1845
hsa:23774
hsa:27154
mmu:268936
mmu:78783
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935
Rank 1 · TkA05G457490 · TK1151
Cytoplasm0.168
Rank 2 · TkA05G457490 · TK1151
Cell membrane0.023
Rank 3 · TkA05G457490 · TK1151
Mitochondrion0.013
Rank 4 · TkA05G457490 · TK1151
Endoplasmic reticulum0.012
Rank 5 · TkA05G457490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25289DUF787723-94 aa
PF00439Bromodomain26-103 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G457490PF25289DUF787723940.005917.8
TkA05G457490PF00439Bromodomain261035.6e-2484.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser