RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G443990
Reference: TK1151 Chr: Chr05 Coordinates: 110981641-110995094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2364 bp · TkA05G443990|TK1151|cDNA

AAAAGGCACAGGACCCATTAATTTTGCGTTATACAAATCACAAGGTAAGAGCCCCAGCCATAGACACATCAAAAAGTCAAAAACATCCTCCACTCTACCTCATCACGTTCTCTGAAAGAGGAGATGGCAAGTTTTTTTCGCGCTCGGCGCGTAGGGGTCACGGCTGCCTCGCTCGCCGTCGCTGTAGGCGGTTCCTATGTTGCACTACGTGATCCTTACGTATCCTCCAGTGACCGGAATGGCAGTGACACAGCGCTAGA...

CDS

Download CDS FASTA

3033 bp · TkA05G443990|TK1151|CDS

ATGGCTTCCGGTGTCAGGATGCTGAACAATGGGAACGGTAAGCATGAGAAGCAGCACGCTACGCCACCGCCTTCTTCTAGAACTGTTGGCTGTGGAGCTGCTGCCTCCGTTCGATCTAAAACACCGTCTTCTTCTGCTTCCAGACGTTCGGTTACCCCCAATTCTCGTTCTCACACTCGCCAGAACGACGAAGATGCAGAACCTGGAAGAGTGAGAGTTGCTATTAGACTACGACCAAAAAACACCGAGGAAATTTCAGA...

Protein

Download Protein FASTA

1010 aa · TkA05G443990|TK1151|PROTEIN

MASGVRMLNNGNGKHEKQHATPPPSSRTVGCGAAASVRSKTPSSSASRRSVTPNSRSHTRQNDEDAEPGRVRVAIRLRPKNTEEISDADFFDCVELQPELMKLKLKKNNWSSDSYRFDEVFTESASQKRVYEAVAKPVVEGVLNGYNGTIMAYGQTGTGKTYTLGKLGKDDASERGIMVRALEDIIASASSASDSVEMSYLQIYMESVQDLLAPEKVNIPIVDDPKNGEVSVPGAAVVKIQNLDHFLHLLQIGEANRHAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G443990
TK1151 IDTkA05G443990
OH-1004 IDLXL04_022076
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G443990
LocationChr05:110981641-110995094 (+)
DescriptionSimilar to KINUC: Kinesin-like protein KIN-UC
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g54870 Acts as a plus-end microtubule-dependent motor protein.
A mutation in MRH2 kinesin enhances the root hair tip growth defect caused by constitutively activated ROP2 small GTPase in Arabidopsis.2007 · DOI: 10.1371/journal.pone.0001074
At3g10370 May participate in glycerol catabolism and NADH/NAD⁺ homeostasis.
SUGAR-DEPENDENT6 encodes a mitochondrial flavin adenine dinucleotide-dependent glycerol-3-p dehydrogenase, which is required for glycerol catabolism and post germinative seedling growth in Arabidopsis.2008 · DOI: 10.1104/pp.108.123703
At1g12430 Kinesin-like protein KIN-UA. No verified direct reference in this release
At1g01950 Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0152900 Kinesin-like protein KIN-UA. No verified direct reference in this release
Os06g0137100 Kinesin-like protein KIN-UB. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022076 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007018 microtubule-based movement Biological Process
GO:0030705 cytoskeleton-dependent intracellular transport Biological Process
GO:0031110 regulation of microtubule polymerization or depolymerization Biological Process
GO:0048364 root development Biological Process
GO:0048765 root hair cell differentiation Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005819 spindle Cellular Component
GO:0005871 kinesin complex Cellular Component
GO:0005874 microtubule Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT1G01950
ath:AT1G12430
ath:AT3G54870
dosa:Os03g0152900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.581
Rank 1 · TkA05G443990 · TK1151
Nucleus0.320
Rank 2 · TkA05G443990 · TK1151
Cell membrane0.143
Rank 3 · TkA05G443990 · TK1151
Golgi apparatus0.068
Rank 4 · TkA05G443990 · TK1151
Lysosome / Vacuole0.060
Rank 5 · TkA05G443990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd69-212 aa
PF00225Kinesin76-413 aa
PF05970PIF1126-175 aa
PF13401AAA_22147-172 aa
PF24768ARM_ARMC5409-524 aa
PF13401AAA_22413-466 aa
PF24627PUMA_CC426-465 aa
PF24627PUMA_CC457-525 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G443990PF16796Microtub_bd692127.8e-1968.8
TkA05G443990PF00225Kinesin764133.6e-96322.7
TkA05G443990PF05970PIF11261750.01915.3
TkA05G443990PF13401AAA_221471720.01116.7
TkA05G443990PF24768ARM_ARMC54095241.3e-1558.3
TkA05G443990PF13401AAA_224134660.01116.7
TkA05G443990PF24627PUMA_CC4264650.00816.9
TkA05G443990PF24627PUMA_CC4575250.00816.9
TkA05G443990PF16796Microtub_bd4645667.8e-1968.8
TkA05G443990PF13401AAA_224795240.01116.7
TkA05G443990PF06696Strep_SA_rep5255400.04114.7
TkA05G443990PF00225Kinesin5365593.6e-96322.7
TkA05G443990PF24768ARM_ARMC55446141.3e-1558.3
TkA05G443990PF24627PUMA_CC5465980.00816.9
TkA05G443990PF06696Strep_SA_rep5806000.04114.7
TkA05G443990PF24627PUMA_CC6346470.00816.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SV36Arabidopsis thalianasp|Q9SV36|KINUC_ARATH Kinesin-like protein KIN-UC61.200%Swiss-ProtHigh
Q9SS48Arabidopsis thalianasp|Q9SS48|SDP6_ARATH Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial80.400%Swiss-ProtHigh
Q9FZ06Arabidopsis thalianasp|Q9FZ06|KINUA_ARATH Kinesin-like protein KIN-UA50.400%Swiss-ProtHigh
Q9LPC6Arabidopsis thalianasp|Q9LPC6|KINUB_ARATH Kinesin-like protein KIN-UB49.700%Swiss-ProtMedium
Q0DV28Oryza sativa subsp. japonicasp|Q0DV28|KINUA_ORYSJ Kinesin-like protein KIN-UA55.700%Swiss-ProtHigh
Q5VQ09Oryza sativa subsp. japonicasp|Q5VQ09|KINUB_ORYSJ Kinesin-like protein KIN-UB49.700%Swiss-ProtMedium

JBrowse

View in Genome Browser