TkA05G437900 | RubberDandelionOmics

Gene overview

TkA05G437900

Reference: TK1151 Chr: Chr05 Coordinates: 109332152-109333654 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA05G437900|TK1151|cDNA

ATGAGTGCGAGACACGTCGAAAGGAGGGCGCCGTTGGCGGGCAGCGATCAGGCTTCGCGTGCGATGAATCGTTATGGTGTGCCGAAGGTAGAGTCGTGGAGGAATTCACCATGGAAACAACCGATTCCACCTTACTTATTCGCATTCGCCGTTGGAGAAATCGCGTATAGGGAAGTTGGCCCCCGGACTAAGGTCTTCGCTGAAGCCGTCCCTGCGGTTCTCGATGCTGCAGCAAAGGAATTCGCAGGATTCACAACTTA...

CDS

Download CDS FASTA

909 bp · TkA05G437900|TK1151|CDS

ATGAGTGCGAGACACGTCGAAAGGAGGGCGCCGTTGGCGGGCAGCGATCAGGCTTCGCGTGCGATGAATCGTTATGGTGTGCCGAAGGTAGAGTCGTGGAGGAATTCACCATGGAAACAACCGATTCCACCTTACTTATTCGCATTCGCCGTTGGAGAAATCGCGTATAGGGAAGTTGGCCCCCGGACTAAGGTCTTCGCTGAAGCCGTCCCTGCGGTTCTCGATGCTGCAGCAAAGGAATTCGCAGGATTCACAACTTA...

Protein

Download Protein FASTA

302 aa · TkA05G437900|TK1151|PROTEIN

MSARHVERRAPLAGSDQASRAMNRYGVPKVESWRNSPWKQPIPPYLFAFAVGEIAYREVGPRTKVFAEAVPAVLDAAAKEFAGFTTYAERRIVEAVQGEDIAALNIGIGWKGLVDELERFKDNMEFTKLLTNQEGVDPDDVYSQVPYEKGFQFLWRIERQKDIDLKMWTEGTGIPSDAMEPVSNIYTKIVSLSNEFKQGRMPSEEEVASWHGQEWELYLENLPKSVEPSQVTALDYRYRLSESKDYEEVGRMKYLRPLYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G437900`
TK1151 ID	TkA05G437900
OH-1004 ID	LXL04_021990
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	59.400
Protein coverage (%)	TK1151 100.000 / OH-1004 73.453 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G437900

Location Chr05:109332152-109333654 (-)

Description Similar to LKHA4: Leucine aminopeptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13520`	Aminopeptidase that preferentially cleaves di- and tripeptides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0819100`	Aminopeptidase that preferentially cleaves di- and tripeptides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021990 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0019370 leukotriene biosynthetic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0043434 response to peptide hormone Biological Process

GO:0120113 cytoplasm to vacuole targeting by the NVT pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G13520

bfu:BCIN_09g05630

bta:507130

dosa:Os03g0819100

hsa:4048

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.625

Rank 1 · TkA05G437900 · TK1151

Mitochondrion0.312

Rank 2 · TkA05G437900 · TK1151

Cytoplasm0.047

Rank 3 · TkA05G437900 · TK1151

Nucleus0.038

Rank 4 · TkA05G437900 · TK1151

Extracellular0.016

Rank 5 · TkA05G437900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01433Peptidase_M183-158 aa

PF09127Leuk-A4-hydro_C210-247 aa

PF09127Leuk-A4-hydro_C247-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G437900	`PF01433`	Peptidase_M1	83	158	0.0037	17.6
TkA05G437900	`PF09127`	Leuk-A4-hydro_C	210	247	1e-08	35.9
TkA05G437900	`PF09127`	Leuk-A4-hydro_C	247	297	1e-08	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY49`	Arabidopsis thaliana	sp\|Q9FY49\|LKHA4_ARATH Leucine aminopeptidase	44.900%	Swiss-Prot	Medium
`Q84TA3`	Oryza sativa subsp. japonica	sp\|Q84TA3\|LKHA4_ORYSJ Leucine aminopeptidase	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card