TkA05G420980 | RubberDandelionOmics

Gene overview

TkA05G420980

Reference: TK1151 Chr: Chr05 Coordinates: 104879941-104887001 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1783 bp · TkA05G420980|TK1151|cDNA

TGTCCACAACGCACTCTATTTCTATTATAAGTAGACTCTTCATCTTGTGAAGTGAACATCAAATAAAAATGAAAACACTTTCTTCTTCATTGGTTATTGATCTTCTTACTCATGTGGTGATCCCCGTAATTACCATTATAACCTTCTACTACTTAAATATCCTATGGATGAAACCTCAAAGATTAAGAAGAAAGCTCGAAAAGCAAGGAATCAGAGGGCCAAAACCGTCTTTTCCATATGGGAATGTGGTTGAGATGCAG...

CDS

Download CDS FASTA

1563 bp · TkA05G420980|TK1151|CDS

ATGAAAACACTTTCTTCTTCATTGGTTATTGATCTTCTTACTCATGTGGTGATCCCCGTAATTACCATTATAACCTTCTACTACTTAAATATCCTATGGATGAAACCTCAAAGATTAAGAAGAAAGCTCGAAAAGCAAGGAATCAGAGGGCCAAAACCGTCTTTTCCATATGGGAATGTGGTTGAGATGCAGAAGATTCAAGCGGCGACGATCGCCATGAATGTTTCAAGGTCAAGCGGTGGAGATTTTGTTGGTGATGA...

Protein

Download Protein FASTA

520 aa · TkA05G420980|TK1151|PROTEIN

MKTLSSSLVIDLLTHVVIPVITIITFYYLNILWMKPQRLRRKLEKQGIRGPKPSFPYGNVVEMQKIQAATIAMNVSRSSGGDFVGDDYTCTLFPYFEQWRKQYGSIYTYSTGNKQHLYINDPELVKEMNQSITLGLGKPSYVTKRLSPLLGNGILRSNGHFWVHQRKIIAPEFFMDKVKGMVGLMSESVEPLLKKWEAFIEGQGGQRADIRVDDDLRAVSADVISRACFGSSYAKGKEIFSKLKTLQKTISSKGMLFGLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G420980`
TK1151 ID	TkA05G420980
OH-1004 ID	LXL04_021784
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G420980

Location Chr05:104879941-104887001 (+)

Description Similar to CYP714A1: Cytochrome P450 714A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24910`	Involved in the inactivation of early gibberellin (GA) intermediates.	Two Arabidopsis cytochrome P450 monooxygenases, CYP714A1 and CYP714A2, function redundantly in plant development through gibberellin deactivation.2011 · DOI: 10.1111/j.1365-313x.2011.04596.x
`At5g24900`	Involved in the inactivation of early gibberellin (GA) intermediates.	Two Arabidopsis cytochrome P450 monooxygenases, CYP714A1 and CYP714A2, function redundantly in plant development through gibberellin deactivation.2011 · DOI: 10.1111/j.1365-313x.2011.04596.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0119000`	Probably not involved in gibberellin metabolism since over-expression of CYP714C2 in a heterologous system does not induce semi-dwarfism.	No verified direct reference in this release
`Os03g0332100`	Catalyzes the 13-hydroxylation of gibberellins (GAs).	CYP714B1 and CYP714B2 encode gibberellin 13-oxidases that reduce gibberellin activity in rice.2013 · DOI: 10.1073/pnas.1215788110

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021784 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference

ath:AT5G24900

ath:AT5G24910

dosa:Os12g0119000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.854

Rank 1 · TkA05G420980 · TK1151

Cytoplasm0.052

Rank 2 · TkA05G420980 · TK1151

Cell membrane0.045

Rank 3 · TkA05G420980 · TK1151

Plastid0.041

Rank 4 · TkA05G420980 · TK1151

Golgi apparatus0.039

Rank 5 · TkA05G420980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45094-504 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G420980	`PF00067`	p450	94	504	4.9e-71	240.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z79`	Arabidopsis thaliana	sp\|Q93Z79\|C14A1_ARATH Cytochrome P450 714A1	61.200%	Swiss-Prot	High
`Q6NKZ8`	Arabidopsis thaliana	sp\|Q6NKZ8\|C14A2_ARATH Cytochrome P450 714A2	56.000%	Swiss-Prot	High
`Q2QYH7`	Oryza sativa subsp. japonica	sp\|Q2QYH7\|C14C2_ORYSJ Cytochrome P450 714C2	50.000%	Swiss-Prot	High
`Q0DS59`	Oryza sativa subsp. japonica	sp\|Q0DS59\|C14B2_ORYSJ Cytochrome P450 714B2	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card