TkA05G397680 | RubberDandelionOmics

Gene overview

TkA05G397680

Reference: TK1151 Chr: Chr05 Coordinates: 98849369-98849791 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA05G397680|TK1151|cDNA

ATGGAAACGCCTACTAAACGACCTGTTCATAAATTCATTTCCAGCAACTCCTTCCACCTCCGTTCTCCCAGTCTCAATTTCGTCCGTCTCCGCCGTATTTTCGATCTCTGCGACGCAAATCACGACTCCTTCATCACCGTCGACGAGATCTACCTCAAAAACCCTCGGCCTCGACATCGACATCTCCGATTTGGGTTCAATGATAAAAACCTACATCCATCCTGGCAATGCTGGCCTCACCTACGACGACTTCGTGATTT...

CDS

Download CDS FASTA

423 bp · TkA05G397680|TK1151|CDS

ATGGAAACGCCTACTAAACGACCTGTTCATAAATTCATTTCCAGCAACTCCTTCCACCTCCGTTCTCCCAGTCTCAATTTCGTCCGTCTCCGCCGTATTTTCGATCTCTGCGACGCAAATCACGACTCCTTCATCACCGTCGACGAGATCTACCTCAAAAACCCTCGGCCTCGACATCGACATCTCCGATTTGGGTTCAATGATAAAAACCTACATCCATCCTGGCAATGCTGGCCTCACCTACGACGACTTCGTGATTT...

Protein

Download Protein FASTA

140 aa · TkA05G397680|TK1151|PROTEIN

METPTKRPVHKFISSNSFHLRSPSLNFVRLRRIFDLCDANHDSFITVDEIYLKNPRPRHRHLRFGFNDKNLHPSWQCWPHLRRLRDFAKVTYTTHLINLDNKPQWRRRFFEILQFIQEKYGFLFVGFSNIMFFCILGFSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G397680`
TK1151 ID	TkA05G397680
OH-1004 ID	LXL04_017930
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 35.714 / OH-1004 41.322 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G397680

Location Chr05:98849369-98849791 (+)

Description Similar to CML42: Calcium-binding protein CML42

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44460`	Calcium-binding protein that may mediate calcium-dependent signal during plant defense response.	Calmodulin-like proteins from Arabidopsis and tomato are involved in host defense against Pseudomonas syringae pv. tomato.2005 · DOI: 10.1007/s11103-005-8395-x
`At4g20780`	Probable calcium sensor that binds calcium in vitro.	Calmodulin-like proteins from Arabidopsis and tomato are involved in host defense against Pseudomonas syringae pv. tomato.2005 · DOI: 10.1007/s11103-005-8395-x The calmodulin-related calcium sensor CML42 plays a role in trichome branching.2009 · DOI: 10.1074/jbc.m109.056770

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010091 trichome branching Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0061891 calcium ion sensor activity Molecular Function

KEGG gene cross-reference

ath:AT4G20780

ath:AT5G44460

dosa:Os03g0331700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.300

Rank 1 · TkA05G397680 · TK1151

Nucleus0.290

Rank 2 · TkA05G397680 · TK1151

Mitochondrion0.254

Rank 3 · TkA05G397680 · TK1151

Endoplasmic reticulum0.146

Rank 4 · TkA05G397680 · TK1151

Cell membrane0.088

Rank 5 · TkA05G397680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_728-50 aa

PF13405EF-hand_629-50 aa

PF00036EF-hand_130-49 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G397680	`PF13499`	EF-hand_7	28	50	0.0028	18.7
TkA05G397680	`PF13405`	EF-hand_6	29	50	0.0014	18.9
TkA05G397680	`PF00036`	EF-hand_1	30	49	0.0067	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI19`	Arabidopsis thaliana	sp\|Q9FI19\|CML43_ARATH Probable calcium-binding protein CML43	66.700%	Swiss-Prot	Low
`Q9SVG9`	Arabidopsis thaliana	sp\|Q9SVG9\|CML42_ARATH Calcium-binding protein CML42	69.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card