TkA05G339150 | RubberDandelionOmics

Gene overview

TkA05G339150

Reference: TK1151 Chr: Chr05 Coordinates: 83844236-83849350 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2069 bp · TkA05G339150|TK1151|cDNA

CTTGCATCTATTTATTATAATATGTTGCAAAGCTTCAATGGAAGTTGAAGACAAAACACCAAATCATCCACCCAACTCTATTATGTACATCATTCAAGTATAAAAGCTAGTAACGTACAAGCTTACTTCGCAAATATTTCTTCTACTTCCTCTTGCTTAATGCCTTCACCACCGTTATCACCACCATTGCCGGAAAATGGTGTCAGAGGAGCCCACGACCACCACTTTCCATCACCATCGCCACAATCAAACTCTGGGCA...

CDS

Download CDS FASTA

1806 bp · TkA05G339150|TK1151|CDS

ATGCCTTCACCACCGTTATCACCACCATTGCCGGAAAATGGTGTCAGAGGAGCCCACGACCACCACTTTCCATCACCATCGCCACAATCAAACTCTGGGCAACGAAAGCCTGGTGGCTGGAAGTCCATGCCCTATGTACTAGGAATGGAGTCATTTGAGAGGTTGGCAACAATCGGGTTATTAGCAAACTTCACAGTGTTCTTAATGACCATTTTCAACATGACCCAAGTGTCATCATCATACTTAATTTATATATGGTC...

Protein

Download Protein FASTA

601 aa · TkA05G339150|TK1151|PROTEIN

MPSPPLSPPLPENGVRGAHDHHFPSPSPQSNSGQRKPGGWKSMPYVLGMESFERLATIGLLANFTVFLMTIFNMTQVSSSYLIYIWSGVGNFAPLVGAYISDAYVGKFWVIAFASFASLIGMIILTLIVAIPSLHPPPCTHLNECQGPTTVHMGVLVLALGFLCIGSGGIRPCSLPFGVDQFDPTNDEGKKGINSFFNWYYTTFTIILLIALTLVVYIQDQVSWFWGFTIPTILMVCSIILYFMGTKMYVYVKPEGSIMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G339150`
TK1151 ID	TkA05G339150
OH-1004 ID	LXL04_008610
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.600
Protein coverage (%)	TK1151 90.183 / OH-1004 92.230 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G339150

Location Chr05:83844236-83849350 (-)

Description Similar to NPF2.11: Protein NRT1/ PTR FAMILY 2.11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69870`	Low-affinity proton-dependent nitrate transporter.	The Arabidopsis nitrate transporter NRT1.7, expressed in phloem, is responsible for source-to-sink remobilization of nitrate.2009 · DOI: 10.1105/tpc.109.067603
`At1g27080`	Low-affinity proton-dependent nitrate transporter.	No verified direct reference in this release
`At1g69860`	Putative protein NRT1/ PTR FAMILY 2.14.	No verified direct reference in this release
`At3g47960`	High-affinity, proton-dependent glucosinolate-specific transporter.	NRT/PTR transporters are essential for translocation of glucosinolate defence compounds to seeds.2012 · DOI: 10.1038/nature11285 Integration of biosynthesis and long-distance transport establish organ-specific glucosinolate profiles in vegetative Arabidopsis.2013 · DOI: 10.1105/tpc.113.110890
`At1g18880`	Low-affinity nitrate transporter facilitating nitrate loading into root phloem.	Arabidopsis nitrate transporter NRT1.9 is important in phloem nitrate transport.2011 · DOI: 10.1105/tpc.111.083618

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008610 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006857 oligopeptide transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010098 suspensor development Biological Process

GO:0010233 phloem transport Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0048316 seed development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0090408 phloem nitrate loading Biological Process

GO:0090449 phloem glucosinolate loading Biological Process

GO:1901349 glucosinolate transport Biological Process

KEGG gene cross-reference

ath:AT1G18880

ath:AT1G27080

ath:AT1G69870

ath:AT3G47960

ath:AT5G62680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.765

Rank 1 · TkA05G339150 · TK1151

Endoplasmic reticulum0.079

Rank 2 · TkA05G339150 · TK1151

Cytoplasm0.077

Rank 3 · TkA05G339150 · TK1151

Lysosome / Vacuole0.066

Rank 4 · TkA05G339150 · TK1151

Mitochondrion0.031

Rank 5 · TkA05G339150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20193DUF655655-76 aa

PF07690MFS_156-174 aa

PF00854PTR2108-542 aa

PF20193DUF6556119-130 aa

PF07690MFS_1195-520 aa

PF20193DUF6556420-448 aa

PF07690MFS_1471-571 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G339150	`PF20193`	DUF6556	55	76	0.34	11.7
TkA05G339150	`PF07690`	MFS_1	56	174	4.5e-06	26.5
TkA05G339150	`PF00854`	PTR2	108	542	1.1e-79	268.8
TkA05G339150	`PF20193`	DUF6556	119	130	0.34	11.7
TkA05G339150	`PF07690`	MFS_1	195	520	4.5e-06	26.5
TkA05G339150	`PF20193`	DUF6556	420	448	0.34	11.7
TkA05G339150	`PF07690`	MFS_1	471	571	4.5e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RX77`	Arabidopsis thaliana	sp\|Q8RX77\|PTR21_ARATH Protein NRT1/ PTR FAMILY 2.13	56.500%	Swiss-Prot	High
`Q9LFX9`	Arabidopsis thaliana	sp\|Q9LFX9\|PTR13_ARATH Protein NRT1/ PTR FAMILY 2.12	50.900%	Swiss-Prot	High
`Q9CAR9`	Arabidopsis thaliana	sp\|Q9CAR9\|PTR20_ARATH Putative protein NRT1/ PTR FAMILY 2.14	46.000%	Swiss-Prot	Medium
`Q944G5`	Arabidopsis thaliana	sp\|Q944G5\|PTR44_ARATH Protein NRT1/ PTR FAMILY 2.10	44.400%	Swiss-Prot	Medium
`Q9M9V7`	Arabidopsis thaliana	sp\|Q9M9V7\|PTR8_ARATH Protein NRT1/ PTR FAMILY 2.9	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card