TkA05G333970 | RubberDandelionOmics

Gene overview

TkA05G333970

Reference: TK1151 Chr: Chr05 Coordinates: 82278891-82280672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1585 bp · TkA05G333970|TK1151|cDNA

AAACATAGTTGTGTATATTAGTATATATCCAAAAAGCGCGCACATTACCACAGCCTGCAAAAATCTGTTTGATAACCAAATCCTTCACTCTCATCTTCTCAAATTCACCTAGCAACAATGAACAATGGAGTACTCTTAAAACCGAATACTCTGTTCCAAATCCCCATCACACCCACTTCCCTTCTTCTCCACTCCAACAAATCCCACTGTTCTTTTTTCTCAATTCAACTTCCCAAACACAAATTACTCTCATTTCATGC...

CDS

Download CDS FASTA

1257 bp · TkA05G333970|TK1151|CDS

ATGAACAATGGAGTACTCTTAAAACCGAATACTCTGTTCCAAATCCCCATCACACCCACTTCCCTTCTTCTCCACTCCAACAAATCCCACTGTTCTTTTTTCTCAATTCAACTTCCCAAACACAAATTACTCTCATTTCATGCCAAATTATCATCCGGGTTTCCTGTTTTTGCCTCAAAAACCCAAATAAAAGGCGAAACCAGCATTCCTAAAACCGAAATTGTTGATTTCGAAGATGAATTTGATGAGGAATTCGAAGA...

Protein

Download Protein FASTA

418 aa · TkA05G333970|TK1151|PROTEIN

MNNGVLLKPNTLFQIPITPTSLLLHSNKSHCSFFSIQLPKHKLLSFHAKLSSGFPVFASKTQIKGETSIPKTEIVDFEDEFDEEFEEEDEDEDEDEDEDEEEDEEIFVPLKNMKQWTRNKPQGFGEGKEYDTSLEDKLLEELEQSRVAQLANVTNLKNNPEDGNPKKEKLPKQKVPEAPPNGVRVRLINLPKKKNIHRDLQAAFKHFSGIINIIPAVLGNEKTREPVCKGFAFVDFKSEKEANRFVDLYSKEPITFGKVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G333970`
TK1151 ID	TkA05G333970
OH-1004 ID	LXL04_020948
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G333970`
Location	Chr05:82278891-82280672 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020948` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.662

Rank 1 · TkA05G333970 · TK1151

Nucleus0.208

Rank 2 · TkA05G333970 · TK1151

Mitochondrion0.106

Rank 3 · TkA05G333970 · TK1151

Cytoplasm0.027

Rank 4 · TkA05G333970 · TK1151

Cell membrane0.012

Rank 5 · TkA05G333970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06284Cytomega_UL8463-103 aa

PF12226Astro_capsid_p64-105 aa

PF05764YL178-126 aa

PF29089Protamine-379-105 aa

PF27116YjiV_N79-126 aa

PF07543PGA291-119 aa

PF00076RRM_1197-249 aa

PF06284Cytomega_UL84268-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G333970	`PF06284`	Cytomega_UL84	63	103	3.5	6.7
TkA05G333970	`PF12226`	Astro_capsid_p	64	105	0.2	11.5
TkA05G333970	`PF05764`	YL1	78	126	0.038	14.8
TkA05G333970	`PF29089`	Protamine-3	79	105	0.12	13.3
TkA05G333970	`PF27116`	YjiV_N	79	126	7.8	7.9
TkA05G333970	`PF07543`	PGA2	91	119	3.3	8.4
TkA05G333970	`PF00076`	RRM_1	197	249	0.0016	19.0
TkA05G333970	`PF06284`	Cytomega_UL84	268	294	3.5	6.7
TkA05G333970	`PF05764`	YL1	310	380	0.038	14.8
TkA05G333970	`PF07543`	PGA2	324	379	3.3	8.4
TkA05G333970	`PF27116`	YjiV_N	327	364	7.8	7.9
TkA05G333970	`PF00076`	RRM_1	396	405	0.0016	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card