TkA05G301690 | RubberDandelionOmics

Gene overview

TkA05G301690

Reference: TK1151 Chr: Chr05 Coordinates: 74392854-74395690 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA05G301690|TK1151|cDNA

ATGGATTGCTCAATCAAGCCCCTTTTCTCTTCCAAATCCATCGGATGCTCTCTTTCTCTGTATTCATCATCTTCTCATCATCGTCAAGCAATCATGGGTTCAGGTGAGGTTAAGCTTTATGATTTCTTAGTTACGGGTTCAATTTCAGCCACTCAAATCATCCATTTGCAGAAGCGCACAGATGCGAAGTGTTTATTGCTTAAGCATGTACTCATAATTATCTTTCTCTCTCATTTAGATGAAGACATGAAGGATTATGG...

CDS

Download CDS FASTA

411 bp · TkA05G301690|TK1151|CDS

ATGGATTGCTCAATCAAGCCCCTTTTCTCTTCCAAATCCATCGGATGCTCTCTTTCTCTGTATTCATCATCTTCTCATCATCGTCAAGCAATCATGGGTTCAGGTGAGGTTAAGCTTTATGATTTCTTAGTTACGGGTTCAATTTCAGCCACTCAAATCATCCATTTGCAGAAGCGCACAGATGCGAAGTGTTTATTGCTTAAGCATGTACTCATAATTATCTTTCTCTCTCATTTAGATGAAGACATGAAGGATTATGG...

Protein

Download Protein FASTA

136 aa · TkA05G301690|TK1151|PROTEIN

MDCSIKPLFSSKSIGCSLSLYSSSSHHRQAIMGSGEVKLYDFLVTGSISATQIIHLQKRTDAKCLLLKHVLIIIFLSHLDEDMKDYGFQYSDEEPEEQNVDIQNQYYNSKGFVETYREGALTGFAEVVQMEPEKEE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G301690`
TK1151 ID	TkA05G301690
OH-1004 ID	LXL04_018525
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.200
Protein coverage (%)	TK1151 86.029 / OH-1004 23.589 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G301690

Location Chr05:74392854-74395690 (+)

Description Similar to CSN2: COP9 signalosome complex subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26990`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Characterization of the last subunit of the Arabidopsis COP9 signalosome: implications for the overall structure and origin of the complex.2003 · DOI: 10.1105/tpc.009092

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000338 protein deneddylation Biological Process

GO:0006366 transcription by RNA polymerase II Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0045116 protein neddylation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:2000434 regulation of protein neddylation Biological Process

KEGG gene cross-reference

ath:AT2G26990

hsa:9318

mmu:12848

rno:261736

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.443

Rank 1 · TkA05G301690 · TK1151

Cytoplasm0.372

Rank 2 · TkA05G301690 · TK1151

Cell membrane0.124

Rank 3 · TkA05G301690 · TK1151

Mitochondrion0.124

Rank 4 · TkA05G301690 · TK1151

Endoplasmic reticulum0.113

Rank 5 · TkA05G301690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W207`	Arabidopsis thaliana	sp\|Q8W207\|CSN2_ARATH COP9 signalosome complex subunit 2	80.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card