RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G291660
Reference: TK1151 Chr: Chr05 Coordinates: 72023648-72031462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4762 bp · TkA05G291660|TK1151|cDNA

CATAGGATATGGAATCTTTGATAGGGATGTTTGTATCATTATAATACGCACATAAGTTAATTTTCTCTATATATATAGCAGAAGAAGGATCAAGACAATTCAAGTAATCACTGTATTGCATCAGCCAACCTCCACTCACCAACCCCCTCCGTCTGAAGAATCGACACGTGAGTCGCTCACCTTTACAGATCCGCATTTCTTAAACTCATCCAATCTTGGATATACATTACCCACTCAATATTTCCACCTCCCTTGTATTT...

CDS

Download CDS FASTA

4362 bp · TkA05G291660|TK1151|CDS

ATGTGGGGTTTTTGTTCTTCAATCGATTTTAGTTTTAGTTTCGAGGTTTTCGAATCTGCGTCAATGGCGGCTATTTTGAATATAGGCAATGTGTGCTTCTTCTTGTGGTTATTCATCTGGGGTTTCGCAGCTATTTTAAAGCAGAGACGAGGCGAAACAACAACATTCCCGATGAATTCCTCACGCTCTTCGATGATTACAGTCGTCTCCACCTTCCCAATCATGATTTCTCATATCGGTTTCTGTGTGTACAAGTTCAT...

Protein

Download Protein FASTA

1453 aa · TkA05G291660|TK1151|PROTEIN

MWGFCSSIDFSFSFEVFESASMAAILNIGNVCFFLWLFIWGFAAILKQRRGETTTFPMNSSRSSMITVVSTFPIMISHIGFCVYKFIKHDVVPLDSIVLALTWCLASVVTVYSFFHRRKWPLVLVLFWCLSTIHYFVSVAFILINYFTSKDMHILLSTSNLIHMTTLPFSIILLFNGVTFCCIANKHKELEIDEPLLQQTSERSTSAFTNSGIWNRVTFNWLNPLFELGRIQKLEFHHVPSIPESETAEEAAYLLEESLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G291660
TK1151 IDTkA05G291660
OH-1004 IDLXL04_020693
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G291660
LocationChr05:72023648-72031462 (-)
DescriptionSimilar to ABCC3: ABC transporter C family member 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g13080 Pump for glutathione S-conjugates.
An ABC-transporter of Arabidopsis thaliana has both glutathione-conjugate and chlorophyll catabolite transport activity.1998 · DOI: 10.1046/j.1365-313x.1998.00076.x
At1g04120 Pump for glutathione S-conjugates.
The Arabidopsis thaliana ABC transporter AtMRP5 controls root development and stomata movement.2001 · DOI: 10.1093/emboj/20.8.1875
The plant multidrug resistance ABC transporter AtMRP5 is involved in guard cell hormonal signalling and water use.2003 · DOI: 10.1046/j.1365-313x.2003.016012.x
Binding of sulfonylurea by AtMRP5, an Arabidopsis multidrug resistance-related protein that functions in salt tolerance.2004 · DOI: 10.1104/pp.103.027045
The Arabidopsis ATP-binding cassette protein AtMRP5/AtABCC5 is a high affinity inositol hexakisphosphate transporter involved in guard cell signaling and phytate storage.2009 · DOI: 10.1074/jbc.m109.030247
At3g13090 Pump for glutathione S-conjugates. No verified direct reference in this release
At3g13100 Pump for glutathione S-conjugates. No verified direct reference in this release
At3g60160 Pump for glutathione S-conjugates. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_020693 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0009651 response to salt stress Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0051707 response to other organism Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT1G04120
ath:AT3G13080
ath:AT3G13090
ath:AT3G13100
ath:AT3G60160
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.353
Rank 1 · TkA05G291660 · TK1151
Lysosome / Vacuole0.321
Rank 2 · TkA05G291660 · TK1151
Cytoplasm0.169
Rank 3 · TkA05G291660 · TK1151
Endoplasmic reticulum0.158
Rank 4 · TkA05G291660 · TK1151
Golgi apparatus0.102
Rank 5 · TkA05G291660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane283-550 aa
PF02463SMC_N569-791 aa
PF13481AAA_25601-645 aa
PF13555AAA_29619-642 aa
PF00005ABC_tran620-750 aa
PF12775AAA_7622-649 aa
PF00006ATP-synt_ab622-647 aa
PF03193RsgA_GTPase626-648 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G291660PF00664ABC_membrane2835501.8e-49169.6
TkA05G291660PF02463SMC_N5697913.7e-0937.0
TkA05G291660PF13481AAA_256016450.02415.0
TkA05G291660PF13555AAA_296196429e-0626.1
TkA05G291660PF00005ABC_tran6207502e-45155.5
TkA05G291660PF12775AAA_76226490.1212.7
TkA05G291660PF00006ATP-synt_ab6226470.2711.6
TkA05G291660PF03193RsgA_GTPase6266480.0009319.8
TkA05G291660PF03308MeaB6266591.28.8
TkA05G291660PF01926MMR_HSR16276531.8e-0525.6
TkA05G291660PF05673DUF8156276480.1511.9
TkA05G291660PF10662PduV-EutP6276440.311.6
TkA05G291660PF13401AAA_226286730.0001522.8
TkA05G291660PF00931NB-ARC6286540.0009119.5
TkA05G291660PF00350Dynamin_N6286480.002818.4
TkA05G291660PF13191AAA_166286580.004218.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LK64Arabidopsis thalianasp|Q9LK64|AB3C_ARATH ABC transporter C family member 350.700%Swiss-ProtHigh
Q7GB25Arabidopsis thalianasp|Q7GB25|AB5C_ARATH ABC transporter C family member 547.000%Swiss-ProtMedium
Q8VZZ4Arabidopsis thalianasp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 647.700%Swiss-ProtMedium
Q9LK62Arabidopsis thalianasp|Q9LK62|AB7C_ARATH ABC transporter C family member 745.600%Swiss-ProtMedium
Q9M1C7Arabidopsis thalianasp|Q9M1C7|AB9C_ARATH ABC transporter C family member 947.100%Swiss-ProtMedium

JBrowse

View in Genome Browser