TkA05G285280 | RubberDandelionOmics

Gene overview

TkA05G285280

Reference: TK1151 Chr: Chr05 Coordinates: 70467035-70468688 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

650 bp · TkA05G285280|TK1151|cDNA

ATGGGTTGGGTTGGAGATGGTCTTATGCTCTCAAGAGTGATGGAGGATATGGATACGAAAGTGAAATCCATGATCAAATTGATTGAAGATGCGGATTCATTTGCAAGGAGGGCAGAAATGTACTACAAGAAGCGACCTGAGCTCATGAAACTGGTGGAAGAGTTCTACCGAGCTTACCGTGCACTAGCGGAACAGTACGATTATGCAACCGGAGAGCTCAGGCATGCCCAAAAGACTCTCCAAGCAGCTTTTCCCGATCA...

CDS

Download CDS FASTA

492 bp · TkA05G285280|TK1151|CDS

ATGGGTTGGGTTGGAGATGGTCTTATGCTCTCAAGAGTGATGGAGGATATGGATACGAAAGTGAAATCCATGATCAAATTGATTGAAGATGCGGATTCATTTGCAAGGAGGGCAGAAATGTACTACAAGAAGCGACCTGAGCTCATGAAACTGGTGGAAGAGTTCTACCGAGCTTACCGTGCACTAGCGGAACAGTACGATTATGCAACCGGAGAGCTCAGGCATGCCCAAAAGACTCTCCAAGCAGCTTTTCCCGATCA...

Protein

Download Protein FASTA

163 aa · TkA05G285280|TK1151|PROTEIN

MGWVGDGLMLSRVMEDMDTKVKSMIKLIEDADSFARRAEMYYKKRPELMKLVEEFYRAYRALAEQYDYATGELRHAQKTLQAAFPDQSQSVDPNSHVVYLSTYCSQIGCRTFIHTWNWFCHHLSKSWPPAACAYSIFNEDFRELPGIFNANELIETYGRDRFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G285280`
TK1151 ID	TkA05G285280
OH-1004 ID	LXL04_015168
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.600
Protein coverage (%)	TK1151 48.466 / OH-1004 23.032 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G285280

Location Chr05:70467035-70468688 (+)

Description Similar to ICDH-1: Isocitrate dehydrogenase [NADP]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03080`	Plant-specific actin binding protein.	No verified direct reference in this release
`At3g22790`	Plant-specific actin binding protein.	A superfamily of actin-binding proteins at the actin-membrane nexus of higher plants.2012 · DOI: 10.1016/j.cub.2012.06.041
`At4g14760`	Plant-specific actin binding protein.	No verified direct reference in this release
`At4g02710`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015168 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006097 glyoxylate cycle Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006102 isocitrate metabolic process Biological Process

GO:0006739 NADP+ metabolic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G65930

nta:107815853

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.432

Rank 1 · TkA05G285280 · TK1151

Cytoplasm0.429

Rank 2 · TkA05G285280 · TK1151

Mitochondrion0.117

Rank 3 · TkA05G285280 · TK1151

Cell membrane0.108

Rank 4 · TkA05G285280 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA05G285280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07765KIP110-67 aa

PF23203KIF21A12-81 aa

PF24481CT398_CC16-89 aa

PF06265YutD-like53-113 aa

PF20158Cas5fv_helical70-106 aa

PF10260SAYSvFN130-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G285280	`PF07765`	KIP1	10	67	1.4e-24	86.7
TkA05G285280	`PF23203`	KIF21A	12	81	0.059	13.9
TkA05G285280	`PF24481`	CT398_CC	16	89	0.078	13.5
TkA05G285280	`PF06265`	YutD-like	53	113	0.0039	17.9
TkA05G285280	`PF20158`	Cas5fv_helical	70	106	0.077	13.8
TkA05G285280	`PF10260`	SAYSvFN	130	155	2.3e-05	24.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HZB5`	Arabidopsis thaliana	sp\|F4HZB5\|NET1D_ARATH Protein NETWORKED 1D	77.200%	Swiss-Prot	Low
`Q9LUI2`	Arabidopsis thaliana	sp\|Q9LUI2\|NET1A_ARATH Protein NETWORKED 1A	81.300%	Swiss-Prot	Low
`F4JIF4`	Arabidopsis thaliana	sp\|F4JIF4\|NET1B_ARATH Protein NETWORKED 1B	68.600%	Swiss-Prot	Medium
`Q9ZQX8`	Arabidopsis thaliana	sp\|Q9ZQX8\|NET1C_ARATH Protein NETWORKED 1C	65.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card