TkA05G214810 | RubberDandelionOmics

Gene overview

TkA05G214810

Reference: TK1151 Chr: Chr05 Coordinates: 53966443-53967319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA05G214810|TK1151|cDNA

GGAAGTAGCAACCATCATCCTTTTCGTCCACCAAAACCAGATGATGTGGCGACAATATGTTACACAAGTGGTACAACTGGAACACCAAAGGGGGCTGCACTTTCCCATGGAAACATGATTGCAAATCTTGCTGGTTGCTGCTTTTATGGTTATTTCAGTTATATATCTTATCTTCCTTTGGCACACATATATGAAAGGTCCAACCAGATCATATTAGCATACTATGGTGGCTCAGTTGGATTTTATCAAGGAGACAACTT...

CDS

Download CDS FASTA

624 bp · TkA05G214810|TK1151|CDS

GGAAGTAGCAACCATCATCCTTTTCGTCCACCAAAACCAGATGATGTGGCGACAATATGTTACACAAGTGGTACAACTGGAACACCAAAGGGGGCTGCACTTTCCCATGGAAACATGATTGCAAATCTTGCTGGTTGCTGCTTTTATGGTTATTTCAGTTATATATCTTATCTTCCTTTGGCACACATATATGAAAGGTCCAACCAGATCATATTAGCATACTATGGTGGCTCAGTTGGATTTTATCAAGGAGACAACTT...

Protein

Download Protein FASTA

207 aa · TkA05G214810|TK1151|PROTEIN

GSSNHHPFRPPKPDDVATICYTSGTTGTPKGAALSHGNMIANLAGCCFYGYFSYISYLPLAHIYERSNQIILAYYGGSVGFYQGDNLKLLDGMAELKPTVFCSVPRLYSRVHDGLLLLLLLLLKSVSVIDTKLGVCGYYRVMNAVKSSGGLREKLFNAVFNAKRQALHKGNNQENISSQKDPLFSFLYIICLILSKSGKNTSPMWKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G214810`
TK1151 ID	TkA05G214810
OH-1004 ID	LXL04_001235
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.400
Protein coverage (%)	TK1151 83.092 / OH-1004 21.583 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G214810

Location Chr05:53966443-53967319 (+)

Description Similar to LACS7: Long chain acyl-CoA synthetase 7, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05970`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation (Probable).	Two long-chain acyl-CoA synthetases from Arabidopsis thaliana involved in peroxisomal fatty acid beta-oxidation.2002 · DOI: 10.1046/j.1365-313x.2002.01405.x Molecular characterization of an Arabidopsis acyl-coenzyme a synthetase localized on glyoxysomal membranes.2002 · DOI: 10.1104/pp.012955 Peroxisomal Acyl-CoA synthetase activity is essential for seedling development in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019646 Analysis of the role of COMATOSE and peroxisomal beta-oxidation in the determination of germination potential in Arabidopsis.2006 · DOI: 10.1093/jxb/erl045
`At5g27600`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation (Probable).	Two long-chain acyl-CoA synthetases from Arabidopsis thaliana involved in peroxisomal fatty acid beta-oxidation.2002 · DOI: 10.1046/j.1365-313x.2002.01405.x Peroxisomal Acyl-CoA synthetase activity is essential for seedling development in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019646 Analysis of the role of COMATOSE and peroxisomal beta-oxidation in the determination of germination potential in Arabidopsis.2006 · DOI: 10.1093/jxb/erl045

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001235 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0001676 long-chain fatty acid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006637 acyl-CoA metabolic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009629 response to gravity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010193 response to ozone Biological Process

GO:0010747 positive regulation of long-chain fatty acid import across plasma membrane Biological Process

GO:0015908 fatty acid transport Biological Process

KEGG gene cross-reference

ath:AT3G05970

ath:AT5G27600

hsa:23305

mmu:216739

rno:117243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.547

Rank 1 · TkA05G214810 · TK1151

Cytoplasm0.185

Rank 2 · TkA05G214810 · TK1151

Mitochondrion0.117

Rank 3 · TkA05G214810 · TK1151

Nucleus0.095

Rank 4 · TkA05G214810 · TK1151

Cell membrane0.088

Rank 5 · TkA05G214810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501AMP-binding7-111 aa

PF29776SteB30-57 aa

PF29776SteB132-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G214810	`PF00501`	AMP-binding	7	111	1.4e-29	103.8
TkA05G214810	`PF29776`	SteB	30	57	0.072	14.2
TkA05G214810	`PF29776`	SteB	132	171	0.072	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPS1`	Arabidopsis thaliana	sp\|Q8LPS1\|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal	56.700%	Swiss-Prot	High
`Q8LKS5`	Arabidopsis thaliana	sp\|Q8LKS5\|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card