TkA05G112270 | RubberDandelionOmics

Gene overview

TkA05G112270

Reference: TK1151 Chr: Chr05 Coordinates: 30063623-30066816 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · TkA05G112270|TK1151|cDNA

ATGGGTAAATATAGAGAGGGAAATCCATCAAGTTTCGAGGCAGTGTGCAGAGGAAAACGATCAAAATCCGCGCCATTTGAAATGGAATCAGAGGAAGCGTGCAAGCGTGGAGAAGAAATGGAGCTGATCGAGGCTGTGCAAGCGGATCGAGGCTGTGGAGAGGAAATGGAGCTGATGATTCCATTTGCAGCTATGACGTTCAAAATCGGTGACGTTGTTGAAGTGTCAGGTTCCGACGAAATGTTCAAGCACTCTTTTCA...

CDS

Download CDS FASTA

993 bp · TkA05G112270|TK1151|CDS

ATGGGTAAATATAGAGAGGGAAATCCATCAAGTTTCGAGGCAGTGTGCAGAGGAAAACGATCAAAATCCGCGCCATTTGAAATGGAATCAGAGGAAGCGTGCAAGCGTGGAGAAGAAATGGAGCTGATCGAGGCTGTGCAAGCGGATCGAGGCTGTGGAGAGGAAATGGAGCTGATGATTCCATTTGCAGCTATGACGTTCAAAATCGGTGACGTTGTTGAAGTGTCAGGTTCCGACGAAATGTTCAAGCACTCTTTTCA...

Protein

Download Protein FASTA

330 aa · TkA05G112270|TK1151|PROTEIN

MGKYREGNPSSFEAVCRGKRSKSAPFEMESEEACKRGEEMELIEAVQADRGCGEEMELMIPFAAMTFKIGDVVEVSGSDEMFKHSFHLARIKSIHADGVEVGYQTRTTQTGEQLVEVVNGNQLRPIPDIIVGDFNYGDFIEVWISQGWWRGVVLGGDQTSCIVYFAYKPIGQQHCVFPKVVNVHDGLFDVQYHNRPNYDGLGLIETVNASQMRYNPDPVTGRFTCTDFVDVWIDGGWWGGIVQGGDHQSAIVYFAYRSMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G112270`
TK1151 ID	TkA05G112270
OH-1004 ID	LXL04_032179
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	37.000
Protein coverage (%)	TK1151 61.212 / OH-1004 90.391 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G112270`
Location	Chr05:30063623-30066816 (-)
Description	Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032179` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0042393 histone binding Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G09320 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · TkA05G112270 · TK1151

Cytoplasm0.486

Rank 2 · TkA05G112270 · TK1151

Cell membrane0.064

Rank 3 · TkA05G112270 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA05G112270 · TK1151

Mitochondrion0.050

Rank 5 · TkA05G112270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07653SH3_265-77 aa

PF05641Agenet70-127 aa

PF25313BRWD_AD133-155 aa

PF07653SH3_2134-157 aa

PF05641Agenet137-166 aa

PF12318FAD-SLDH142-164 aa

PF05641Agenet179-214 aa

PF25313BRWD_AD213-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G112270	`PF07653`	SH3_2	65	77	1.1	9.8
TkA05G112270	`PF05641`	Agenet	70	127	1.5e-13	51.7
TkA05G112270	`PF25313`	BRWD_AD	133	155	0.014	16.1
TkA05G112270	`PF07653`	SH3_2	134	157	1.1	9.8
TkA05G112270	`PF05641`	Agenet	137	166	1.5e-13	51.7
TkA05G112270	`PF12318`	FAD-SLDH	142	164	0.18	12.8
TkA05G112270	`PF05641`	Agenet	179	214	1.5e-13	51.7
TkA05G112270	`PF25313`	BRWD_AD	213	244	0.014	16.1
TkA05G112270	`PF05641`	Agenet	229	256	1.5e-13	51.7
TkA05G112270	`PF12318`	FAD-SLDH	232	253	0.18	12.8
TkA05G112270	`PF07653`	SH3_2	233	245	1.1	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card