TkA05G087540 | RubberDandelionOmics

Gene overview

TkA05G087540

Reference: TK1151 Chr: Chr05 Coordinates: 23657907-23661805 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1857 bp · TkA05G087540|TK1151|cDNA

ATGGAGTTAGGGAGTAGAGGAGTCAAATTAGACGCGCCAACCATTAACAACGTTAAACCCACCGTGGCACCTTCATCGTCATTAGGTAGAAGCAATATGAACCCTACTACAAACAACAACCACACCTTGGCTCAATATGGTGCTGATGCGATGTTATTGTCGGAGTTTGAGAAGTCCGTCGGATCTGGTAAGTCTTTTAACTACTCCGATTTGCTTACAAATGCACCAAACGCTGTGGCGGAAAAGGAAATGACTGCTTA...

CDS

Download CDS FASTA

1857 bp · TkA05G087540|TK1151|CDS

ATGGAGTTAGGGAGTAGAGGAGTCAAATTAGACGCGCCAACCATTAACAACGTTAAACCCACCGTGGCACCTTCATCGTCATTAGGTAGAAGCAATATGAACCCTACTACAAACAACAACCACACCTTGGCTCAATATGGTGCTGATGCGATGTTATTGTCGGAGTTTGAGAAGTCCGTCGGATCTGGTAAGTCTTTTAACTACTCCGATTTGCTTACAAATGCACCAAACGCTGTGGCGGAAAAGGAAATGACTGCTTA...

Protein

Download Protein FASTA

618 aa · TkA05G087540|TK1151|PROTEIN

MELGSRGVKLDAPTINNVKPTVAPSSSLGRSNMNPTTNNNHTLAQYGADAMLLSEFEKSVGSGKSFNYSDLLTNAPNAVAEKEMTAYLEAIQRGGFVQPFGCMIAVEEPTFKIISFSENCYGMLGLNSNEPTTSLLRIDARTLFMASSRVLVFRLYFLLERFNHKCLLERVLGCNLSLEEISGLYLRLCFSKFYMSFTPPADLNSQNAGSSSSFVRQRVLRDSRANNFVYNQCCKSGTVVLPPLIEPPADLICLFRTSEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G087540`
TK1151 ID	TkA05G087540
OH-1004 ID	LXL04_013938
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.800
Protein coverage (%)	TK1151 50.162 / OH-1004 18.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G087540

Location Chr05:23657907-23661805 (-)

Description Similar to rpa1: Replication protein A 70 kDa DNA-binding subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18130`	Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region.	No verified direct reference in this release
`At4g16250`	Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013938 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

KEGG gene cross-reference

dre:327491

hsa:6117

pon:100173266

spo:2541158

xla:397937

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · TkA05G087540 · TK1151

Cytoplasm0.183

Rank 2 · TkA05G087540 · TK1151

Mitochondrion0.039

Rank 3 · TkA05G087540 · TK1151

Cell membrane0.014

Rank 4 · TkA05G087540 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA05G087540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08446PAS_286-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G087540	`PF08446`	PAS_2	86	149	2.7e-16	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42498`	Arabidopsis thaliana	sp\|P42498\|PHYE_ARATH Phytochrome E	50.700%	Swiss-Prot	Low
`P42497`	Arabidopsis thaliana	sp\|P42497\|PHYD_ARATH Phytochrome D	49.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card