TkA05G074500 | RubberDandelionOmics

Gene overview

TkA05G074500

Reference: TK1151 Chr: Chr05 Coordinates: 19833740-19834718 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

850 bp · TkA05G074500|TK1151|cDNA

CAACGATGGTGTTCTTCGCTAGAATATGAATGCTACCCTCCACTTGCTTCTATACGACAACAAGTTTCTTTCACGGATATCAGAGTCAACTGTCCCACTTTCTCTCAAGTTTCGCTCTTTTCATTTCTAGAAGTTTGCTTGCAGGAATACTGTTAAAGATTCTAAGTCCGGCTTCCTATTTCTGATAAAGAAAATGAAGAAGGAGCATGTGATGTTGATTCTATGCACAATTGTCATAGCAATCCCATTGGTTCAAAGCA...

CDS

Download CDS FASTA

567 bp · TkA05G074500|TK1151|CDS

ATGAAGAAGGAGCATGTGATGTTGATTCTATGCACAATTGTCATAGCAATCCCATTGGTTCAAAGCATTTCTGAAGGGCGAAAAGGAGTGGAAAAATGGTTCAAGCAGCTCCCACTCAAAAAACAAAAGGTCACAAAGCTACATTTCTATTTTCACGACACCACCACCGGGCCAAGTCAAACCGCGTATCAAATATTCGAGTCAAACATCAGCTCGACCACCATCACCCAATTTGGTCGAGCCTTCATGTTTGACAACCC...

Protein

Download Protein FASTA

188 aa · TkA05G074500|TK1151|PROTEIN

MKKEHVMLILCTIVIAIPLVQSISEGRKGVEKWFKQLPLKKQKVTKLHFYFHDTTTGPSQTAYQIFESNISSTTITQFGRAFMFDNPLTVEPDVRSMTIGKGQGFFGAASFERPRFLMNLNFVFTQGKFNGSTLQFLGTNPILNPVREMSIVGGTGVFRLARGIATAETYFLNDTSSIVEYNLVVLHY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G074500`
TK1151 ID	TkA05G074500
OH-1004 ID	LXL04_019677
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 48.831 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G074500

Location Chr05:19833740-19834718 (-)

Description Similar to DIR23: Dirigent protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65870`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At2g21100`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At1g22900`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At1g58170`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At2g21110`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019677 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0048046 apoplast Cellular Component

GO:0140859 pterocarpan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G21100

gmx:100500621

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.296

Rank 1 · TkA05G074500 · TK1151

Lysosome / Vacuole0.277

Rank 2 · TkA05G074500 · TK1151

Endoplasmic reticulum0.218

Rank 3 · TkA05G074500 · TK1151

Cytoplasm0.101

Rank 4 · TkA05G074500 · TK1151

Cell membrane0.075

Rank 5 · TkA05G074500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03018Dirigent44-185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G074500	`PF03018`	Dirigent	44	185	1.1e-47	162.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SS03`	Arabidopsis thaliana	sp\|Q9SS03\|DIR21_ARATH Dirigent protein 21	39.100%	Swiss-Prot	Medium
`Q84TH6`	Arabidopsis thaliana	sp\|Q84TH6\|DIR23_ARATH Dirigent protein 23	37.600%	Swiss-Prot	Medium
`Q67YM6`	Arabidopsis thaliana	sp\|Q67YM6\|DIR11_ARATH Dirigent protein 11	41.900%	Swiss-Prot	Medium
`Q9C523`	Arabidopsis thaliana	sp\|Q9C523\|DIR19_ARATH Dirigent protein 19	42.400%	Swiss-Prot	Medium
`Q9SKQ2`	Arabidopsis thaliana	sp\|Q9SKQ2\|DIR4_ARATH Dirigent protein 4	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card