TkA05G074020 | RubberDandelionOmics

Gene overview

TkA05G074020

Reference: TK1151 Chr: Chr05 Coordinates: 19707922-19711833 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2710 bp · TkA05G074020|TK1151|cDNA

CCTAGTTTTCAGTTGGGCGGAAATGGATATTTATCCGAAAACGGTCACAAGGACAGCGAAAAAAATGGGGAAGAAGAGGAAGAGGGAGAGAGGAAGCATACATCCCCGGAACAAATACTCCGACAATCCGCCGGATTTTGGTGTTTTGGCGTCACTGTATCCCTCATTTCAATCTTATGTCTTCTACTCTCGAGAAGGAAAGCCAAGGATCGACTGGAAAGACTTCAATGCCACTCGTGAGCTCACGAGGGTTTTGCTAT...

CDS

Download CDS FASTA

1359 bp · TkA05G074020|TK1151|CDS

ATGGATATTTATCCGAAAACGGTCACAAGGACAGCGAAAAAAATGGGGAAGAAGAGGAAGAGGGAGAGAGGAAGCATACATCCCCGGAACAAATACTCCGACAATCCGCCGGATTTTGGTGTTTTGGCGTCACTGTATCCCTCATTTCAATCTTATGTCTTCTACTCTCGAGAAGGAAAGCCAAGGATCGACTGGAAAGACTTCAATGCCACTCGTGAGCTCACGAGGGTTTTGCTATTGCATGATCACTCCATCACCTG...

Protein

Download Protein FASTA

452 aa · TkA05G074020|TK1151|PROTEIN

MDIYPKTVTRTAKKMGKKRKRERGSIHPRNKYSDNPPDFGVLASLYPSFQSYVFYSREGKPRIDWKDFNATRELTRVLLLHDHSITWWIPDGQLCPTVPNRSNYIHWIEDLLSSDIIPNSHEGNNVITGFDIGTGANCIYPLLGASLLGWSFVGTDVTDVALEWAERNVNNNPQISNLIEIRKVDFEEQLTKKKQNTNNDYHGPPILSGVVKIGERFDFCMCNPPFFETMEEAGLNPNTSCGGTLAEMVCPGGEQAFISR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G074020`
TK1151 ID	TkA05G074020
OH-1004 ID	LXL04_019669
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 96.903 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G074020`
Location	Chr05:19707922-19711833 (+)
Description	Similar to mettl16: RNA N6-adenosine-methyltransferase mettl16
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019669` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001510 RNA methylation Biological Process GO:0006397 mRNA processing Biological Process GO:0006402 mRNA catabolic process Biological Process GO:0006556 S-adenosylmethionine biosynthetic process Biological Process GO:0010608 post-transcriptional regulation of gene expression Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process GO:0061157 mRNA destabilization Biological Process GO:0070475 rRNA base methylation Biological Process GO:0120049 snRNA (adenine-N6)-methylation Biological Process GO:1905869 negative regulation of 3'-UTR-mediated mRNA stabilization Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	gga:431184 hsa:79066 mmu:67493 xla:443759 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.641

Rank 1 · TkA05G074020 · TK1151

Cytoplasm0.458

Rank 2 · TkA05G074020 · TK1151

Mitochondrion0.076

Rank 3 · TkA05G074020 · TK1151

Cell membrane0.031

Rank 4 · TkA05G074020 · TK1151

Endoplasmic reticulum0.028

Rank 5 · TkA05G074020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05971Methyltransf_1024-320 aa

PF06325PrmA124-182 aa

PF05175MTS130-196 aa

PF08241Methyltransf_11131-188 aa

PF08242Methyltransf_12131-189 aa

PF05175MTS215-231 aa

PF08241Methyltransf_11371-393 aa

PF08242Methyltransf_12378-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G074020	`PF05971`	Methyltransf_10	24	320	2.8e-83	280.5
TkA05G074020	`PF06325`	PrmA	124	182	0.06	13.5
TkA05G074020	`PF05175`	MTS	130	196	0.018	15.3
TkA05G074020	`PF08241`	Methyltransf_11	131	188	0.18	13.2
TkA05G074020	`PF08242`	Methyltransf_12	131	189	0.22	13.0
TkA05G074020	`PF05175`	MTS	215	231	0.018	15.3
TkA05G074020	`PF08241`	Methyltransf_11	371	393	0.18	13.2
TkA05G074020	`PF08242`	Methyltransf_12	378	391	0.22	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card