Gene Card
Gene overview
cDNA / CDS / Protein Sequences
cDNA
No cDNA sequence is available for this reference.
450 bp · TkA05G070450|TK1151|CDS
GGCGATTGTGGTTTGGAAAGTTCGTCAGAATGGGAAGGGGAATTTTTCCCTGGTATTCCCAAAATTAAGTACGAGGGACCCACAAGCAAGAATCCACTTGCATTCAAATGGTACAATGCCAATGAAGAAATTCTCGGCAAGAATATGAAGGATTGGATGCGATTTAGTGTTGCTTTTTGGCACACATTTCGTGGAACAGGAGGTGATCCTTTTGGTGCAGCTACTAAAATGTGGCCATGGGAAGATGGTACTAATTCTTT...
Protein
Download Protein FASTA150 aa · TkA05G070450|TK1151|PROTEIN
GDCGLESSSEWEGEFFPGIPKIKYEGPTSKNPLAFKWYNANEEILGKNMKDWMRFSVAFWHTFRGTGGDPFGAATKMWPWEDGTNSLNMAKRRMRANFEFLETLGVDRWCFHDRDIAQDGKTLEESNANLDEIVALAKELQGTKIRPLWG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G070450 |
|---|---|
| TK1151 ID | TkA05G070450 |
| OH-1004 ID | LXL04_023734 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 74.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 60.223Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G070450 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr05:18864392-18865668 (-) | ||||||
| Description | Similar to XYLA: Xylose isomerase | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0042732 D-xylose metabolic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009536 plastid Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0009045 xylose isomerase activity Molecular Function GO:0046872 metal ion binding Molecular Function | ||||||
| KEGG gene cross-reference | ate:Athe_0603 ath:AT5G57655 tex:Teth514_0153 tpd:Teth39_2060 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02536mTERF43-109 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G070450 | PF02536 | mTERF | 43 | 109 | 0.48 | 10.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FKK7 | Arabidopsis thaliana | sp|Q9FKK7|XYLA_ARATH Xylose isomerase | 79.500% | Swiss-Prot | High |